Tested Applications
Positive WB detected in | A549 cells, HEK-293 cells, HepG2 cells, MDCK cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
27638-1-AP targets Claudin 16 in WB, ELISA applications and shows reactivity with Human, Canine samples.
Tested Reactivity | Human, Canine |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26531 Product name: Recombinant human CLDN16 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC069682 Sequence: MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLATMRD Predict reactive species |
Full Name | claudin 16 |
Calculated Molecular Weight | 305 aa, 34 kDa |
Observed Molecular Weight | 34 kDa |
GenBank Accession Number | BC069682 |
Gene Symbol | CLDN16 |
Gene ID (NCBI) | 10686 |
RRID | AB_2880935 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y5I7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Claudin 16 antibody 27638-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |