CoraLite® Plus 647-conjugated CLEC12A Polyclonal antibody

• 

  IF Staining of U-937 using CL647-28627

  Immunofluorescent analysis of (4% PFA) fixed U-937 cells using CoraLite® Plus 647 CLEC12A antibody (CL647-28627) at dilution of 1:200.

CLEC12A Polyclonal Antibody for IF/ICC

Cat No. CL647-28627

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

C type lectin like molecule 1, CD371, CLL 1, CLL1, CLL-1

---

Tested Applications

• Positive IF/ICC detected in: U-937 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-28627 targets CLEC12A in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27864

  Product name: Recombinant human CLEC12A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-213 aa of BC063424

  Sequence: MSEEVTYADLQFQNSSEMEKIPEIGKFGEKAPPAPSHVWRPAALFLTLLCLLLLIGLGVLASMFHVTLKIEMKKMNKLQNISEELQRNISLQLMSNMNISNKIRNLSTTLQTIATKLCRELYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIINSSA

• Full Name: C-type lectin domain family 12, member A
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 55-75 kDa
• GenBank Accession Number: BC063424
• Gene Symbol: CLEC12A
• Gene ID (NCBI): 160364
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5QGZ9
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CLEC12A, also known as CD371, MICL, DCAL-2 or CLL-1, is a type II transmembrane glycoprotein and a member of the C-type lectin superfamily (PMID: 30401586). This protein, which contains a single C-type lectin-like domain and a cytoplasmic immunoreceptor tyrosine-based inhibitory motif (ITIM), is related to LOX-1 and Dectin-1 and is variably spliced and highly N-glycosylated (PMID: 14739280). Its ITIM sequence recruits the tyrosine phosphatases SHP-1 and SHP-2 to negatively regulate Syk signaling. In humans, CLEC12A is mainly expressed on myeloid cells, being found on monocytes, granulocytes, macrophages and DC subsets, and at lower levels on CD4+ T cells (PMID: 32477350). The observed molecular weight of CLEC12A is between 40 and 75 kDa, which is much higher than the predicted molecular weight due to glycosylation (PMID: 14739280).