Use Able AI chat for product recommendations

CoraLite® Plus 647-conjugated CLEC12A Polyclonal antibody

CLEC12A Polyclonal Antibody for IF/ICC

Cat No. CL647-28627

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

C type lectin like molecule 1, CD371, CLL 1, CLL1, CLL-1

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inU-937 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-28627 targets CLEC12A in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27864

Product name: Recombinant human CLEC12A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-213 aa of BC063424

Sequence: MSEEVTYADLQFQNSSEMEKIPEIGKFGEKAPPAPSHVWRPAALFLTLLCLLLLIGLGVLASMFHVTLKIEMKKMNKLQNISEELQRNISLQLMSNMNISNKIRNLSTTLQTIATKLCRELYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIINSSA

Predict reactive species
Full Name C-type lectin domain family 12, member A
Calculated Molecular Weight 31 kDa
Observed Molecular Weight55-75 kDa
GenBank Accession NumberBC063424
Gene Symbol CLEC12A
Gene ID (NCBI) 160364
RRIDAB_3748532
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ5QGZ9
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CLEC12A, also known as CD371, MICL, DCAL-2 or CLL-1, is a type II transmembrane glycoprotein and a member of the C-type lectin superfamily (PMID: 30401586). This protein, which contains a single C-type lectin-like domain and a cytoplasmic immunoreceptor tyrosine-based inhibitory motif (ITIM), is related to LOX-1 and Dectin-1 and is variably spliced and highly N-glycosylated (PMID: 14739280). Its ITIM sequence recruits the tyrosine phosphatases SHP-1 and SHP-2 to negatively regulate Syk signaling. In humans, CLEC12A is mainly expressed on myeloid cells, being found on monocytes, granulocytes, macrophages and DC subsets, and at lower levels on CD4+ T cells (PMID: 32477350). The observed molecular weight of CLEC12A is between 40 and 75 kDa, which is much higher than the predicted molecular weight due to glycosylation (PMID: 14739280).

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 CLEC12A antibody CL647-28627Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...