CLIC1 Recombinant monoclonal antibody

CLIC1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 85831-4-RR
Clone No.250143E11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

G6, NCC27

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, rat spleen tissue, HL-60 cells, C2C12 cells, RAW 264.7 cells, C6 cells, mouse spleen tissue
Positive IHC detected inmouse kidney tissue, rat spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85831-4-RR targets CLIC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6049

Product name: Recombinant human CLIC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-241 aa of BC064527

Sequence: MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK

Predict reactive species
Full Name chloride intracellular channel 1
Calculated Molecular Weight 27 kDa
Observed Molecular Weight27-32 kDa
GenBank Accession NumberBC064527
Gene Symbol CLIC1
Gene ID (NCBI) 1192
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00299
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Chloride intracellular channel protein 1 (CLIC1) is a member of the chloride intracellular channel protein family. It plays a crucial role in various cellular processes, including the regulation of chloride ion transport, cell viability, and mitochondrial function. CLIC1 is involved in the formation of membrane-inserted channels that facilitate chloride ion movement, which is essential for maintaining cellular homeostasis and function (PMID: 32116799). Additionally, CLIC1 has been implicated in cancer progression, where it influences cell proliferation, migration, and invasion (PMID: 38027011).

Protocols

Product Specific Protocols
IF protocol for CLIC1 antibody 85831-4-RRDownload protocol
IHC protocol for CLIC1 antibody 85831-4-RRDownload protocol
WB protocol for CLIC1 antibody 85831-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...