Tested Applications
| Positive WB detected in | HuH-7 cells, pig heart tissue, HeLa cells, U2Os cells, pig kidney tissue, rabbit kidney tissue, rat kidney tissue, mouse kidney tissue, rat brain tissue, mouse brain tissue |
| Positive IHC detected in | human heart tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | BT-549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IF | See 1 publications below |
Product Information
66343-1-Ig targets CLIC4 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat, pig samples.
| Tested Reactivity | human, rat, pig |
| Cited Reactivity | rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2942 Product name: Recombinant human CLIC4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-253 aa of BC012444 Sequence: MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK Predict reactive species |
| Full Name | chloride intracellular channel 4 |
| Calculated Molecular Weight | 253 aa, 29 kDa |
| Observed Molecular Weight | 29 kDa |
| GenBank Accession Number | BC012444 |
| Gene Symbol | CLIC4 |
| Gene ID (NCBI) | 25932 |
| RRID | AB_2881723 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9Y696 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIC4 is a p53- and tumor necrosis factor alpha-regulated cytoplasmic and mitochondrial protein that belongs to the CLIC family of intracellular chloride channels. CLICs have actions distinct from traditional cell membrane chloride channels, including formation of ion channels in intracellular organelles and roles in membrane trafficking, apoptosis, and cell differentiation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CLIC4 antibody 66343-1-Ig | Download protocol |
| IHC protocol for CLIC4 antibody 66343-1-Ig | Download protocol |
| WB protocol for CLIC4 antibody 66343-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

















