Tested Applications
Positive WB detected in | SH-SY5Y cells, HEK-293 cells |
Positive IP detected in | HEK-293 cells |
Positive IHC detected in | human colon tissue, human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
20315-1-AP targets CLN6 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14159 Product name: Recombinant human CLN6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 121-190 aa of BC010849 Sequence: IMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNLKPETLIDSFELLYYYDEYLGHCMWYIPFFLILF Predict reactive species |
Full Name | ceroid-lipofuscinosis, neuronal 6, late infantile, variant |
Calculated Molecular Weight | 311 aa, 36 kDa |
Observed Molecular Weight | 30 kDa |
GenBank Accession Number | BC010849 |
Gene Symbol | CLN6 |
Gene ID (NCBI) | 54982 |
RRID | AB_2878671 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NWW5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CLN6 antibody 20315-1-AP | Download protocol |
IHC protocol for CLN6 antibody 20315-1-AP | Download protocol |
IP protocol for CLN6 antibody 20315-1-AP | Download protocol |
WB protocol for CLN6 antibody 20315-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |