Clusterin Polyclonal antibody

• 

  WB analysis of human plasma using 12289-1-AP

  human plasma were subjected to SDS PAGE followed by western blot with 12289-1-AP (Clusterin antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 12289-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12289-1-AP (Clusterin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 12289-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12289-1-AP (Clusterin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 12289-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 12289-1-AP (Clusterin antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 12289-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 12289-1-AP (Clusterin antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 12289-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12289-1-AP (Clusterin antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast cancer using 12289-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12289-1-AP (Clusterin antibody at dilution of 1:50 (under 40x lens).

• 

  IF Staining of human liver using 12289-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human liver tissue using Clusterin antibody (12289-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of human liver using 12289-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human liver tissue using Clusterin antibody (12289-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HeLa using 12289-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using Clusterin antibody (12289-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

Clusterin Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 12289-1-AP

Publications(30)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IF-P, CoIP, ELISA

Synonyms

AAG4, Aging-associated gene 4 protein, Apo J, APOJ, Apo-J

---

Tested Applications

• Positive WB detected in: human plasma
• Positive IHC detected in: human tonsillitis tissue, human breast cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human liver tissue, HeLa cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 17 publications below
• IHC: See 6 publications below
• IF: See 6 publications below
• CoIP: See 1 publications below

Product Information

12289-1-AP targets Clusterin in WB, IHC, IF/ICC, IF-P, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rabbit
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2889

  Product name: Recombinant human CLU protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 101-449 aa of BC010514

  Sequence: VCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

• Full Name: clusterin
• Calculated Molecular Weight: 449 aa, 53 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC010514
• Gene Symbol: CLU
• Gene ID (NCBI): 1191
• RRID: AB_2083316
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10909
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Clusterin (Apolipoprotein J) is a 75-80 kDa heterodimeric glycoprotein produced by a wide array of tissues and found in most biologic fluids (PMID: 7648419; 11906815). It is encoded by one single gene and cleaved posttranslationally into α (34-36 kDa) and β (36-39 kDa) subunits prior to secretion from the cell. Many functions have been described for clusterin, including regulating apoptosis, transporting lipids, controlling cell interactions, regulating complement (PMID: 10694874).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		J Clin Invest; Chromosomal 3q amplicon encodes essential regulators of secretory vesicles that drive secretory addiction in cancer; Authors - Xiaochao Tan
human	WB	Proc Natl Acad Sci U S A; Addiction to Golgi-resident PI4P synthesis in chromosome 1q21.3-amplified lung adenocarcinoma cells.; Authors - Lei Shi
		Sci Signal; Platelets contribute to amyloid-β aggregation in cerebral vessels through integrin αIIbβ3-induced outside-in signaling and clusterin release.; Authors - Lili Donner
	WB	Front Cell Dev Biol; Structural and Functional Characterization of Fibronectin in Extracellular Vesicles From Hepatocytes.; Authors - Xinlei Li
human	WB	Ecotoxicol Environ Saf; Identification and functional analysis of senescence-associated secretory phenotype of premature senescent hepatocytes induced by hexavalent chromium.; Authors - Yu Ma
	IHC	Food Chem Toxicol; Clusterin overexpression as a potential neuroprotective response to the pathological effects of high fat dieting on the brain reward system.; Authors - Carmen Rodríguez-Rivera

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

George (Verified Customer) (12-03-2018)

IHC performed on paraffin-embedded human kidney tissue

• Applications: Immunohistochemistry,
• Primary Antibody Dilution: 1:200
• Cell Tissue Type: human

Clusterin Antibody Immunohistochemistry, validation (1:200 dilution) in human (Cat no:12289-1-AP)