CoraLite® Plus 488-conjugated Clusterin Polyclonal antibody

• 

  IF Staining of human liver using CL488-12289

  Immunofluorescent analysis of (4% PFA) fixed human liver tissue using CoraLite® Plus 488 Clusterin antibody (CL488-12289) at dilution of 1:100.

• 

  IF Staining of human liver using CL488-12289

  Immunofluorescent analysis of (4% PFA) fixed human liver tissue using CoraLite® Plus 488 Clusterin antibody (CL488-12289) at dilution of 1:100.

• 

  IF Staining of HeLa using CL488-12289

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 Clusterin antibody (CL488-12289) at dilution of 1:200.

Clusterin Polyclonal Antibody for IF/ICC, IF-P

Cat No. CL488-12289

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, IF-P

Synonyms

ApoJalpha, Apo-J, APOJ, Apo J, Aging-associated gene 4 protein

---

Tested Applications

• Positive IF-P detected in: human liver tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-12289 targets Clusterin in IF/ICC, IF-P applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2889

  Product name: Recombinant human CLU protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 101-449 aa of BC010514

  Sequence: VCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

• Full Name: clusterin
• Calculated Molecular Weight: 449 aa, 53 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC010514
• Gene Symbol: CLU
• Gene ID (NCBI): 1191
• RRID: AB_3083924
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10909
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Clusterin (Apolipoprotein J) is a 75-80 kDa heterodimeric glycoprotein produced by a wide array of tissues and found in most biologic fluids (PMID: 7648419; 11906815). It is encoded by one single gene and cleaved posttranslationally into α (34-36 kDa) and β (36-39 kDa) subunits prior to secretion from the cell. Many functions have been described for clusterin, including regulating apoptosis, transporting lipids, controlling cell interactions, regulating complement (PMID: 10694874).