Tested Applications
| Positive WB detected in | K-562 cells, mouse liver tissue |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
24030-1-AP targets CMC1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21224 Product name: Recombinant human CMC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC052644 Sequence: MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM Predict reactive species |
| Full Name | COX assembly mitochondrial protein homolog (S. cerevisiae) |
| Calculated Molecular Weight | 106 aa, 12 kDa |
| Observed Molecular Weight | 12-15 kDa |
| GenBank Accession Number | BC052644 |
| Gene Symbol | CMC1 |
| Gene ID (NCBI) | 152100 |
| RRID | AB_2879409 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7Z7K0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CMC1 antibody 24030-1-AP | Download protocol |
| IP protocol for CMC1 antibody 24030-1-AP | Download protocol |
| WB protocol for CMC1 antibody 24030-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







