CMC1 Polyclonal antibody

• 

  WB analysis using 24030-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24030-1-AP (CMC1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 24030-1-AP

  IP result of anti-CMC1 (IP:24030-1-AP, 4ug; Detection:24030-1-AP 1:300) with K-562 cells lysate 4000 ug.

• 

  IHC staining of human liver cancer using 24030-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24030-1-AP (CMC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 24030-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24030-1-AP (CMC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CMC1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 24030-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, IHC, ELISA

Synonyms

C3orf68, CMC1, Cmc1p

---

Tested Applications

• Positive WB detected in: K-562 cells, mouse liver tissue
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

24030-1-AP targets CMC1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21224

  Product name: Recombinant human CMC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-106 aa of BC052644

  Sequence: MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM

• Full Name: COX assembly mitochondrial protein homolog (S. cerevisiae)
• Calculated Molecular Weight: 106 aa, 12 kDa
• Observed Molecular Weight: 12-15 kDa
• GenBank Accession Number: BC052644
• Gene Symbol: CMC1
• Gene ID (NCBI): 152100
• RRID: AB_2879409
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z7K0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Oncol; A novel defined cuproptosis-related gene signature for predicting the prognosis of colon adenocarcinoma; Authors - Bixian Luo