Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26559-1-AP targets CMTM4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23648 Product name: Recombinant human CMTM4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-82 aa of BC093679 Sequence: MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFICIETIMACSPCE Predict reactive species |
| Full Name | CKLF-like MARVEL transmembrane domain containing 4 |
| Observed Molecular Weight | 26 kDa |
| GenBank Accession Number | BC093679 |
| Gene Symbol | CMTM4 |
| Gene ID (NCBI) | 146223 |
| RRID | AB_3085882 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IZR5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CMTM4 belongs to the CKLF-like MARVEL transmembrane domain containing (CMTM) family which contain a structurally conserved MAL and related proteins for vesicle trafficking and membrane linking (MARVEL) domain (PMID: 32944388). CMTM4 plays an important role in mediating endothelial barrier function and controlling vascular sprouting (PMID: 30097810). CMTM4 has been reported to be the major regulator of PD-L1 in liver cancer (PMID: 34558800) and play a tumor suppressive role in colorectal cancer (PMID: 31435638).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CMTM4 antibody 26559-1-AP | Download protocol |
| WB protocol for CMTM4 antibody 26559-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





