CMTM4 Polyclonal antibody

• 

  WB analysis using 26559-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26559-1-AP (CMTM4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse stomach using 26559-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 26559-1-AP (CMTM4 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse stomach using 26559-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 26559-1-AP (CMTM4 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CMTM4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26559-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Chemokine-like factor superfamily member 4, CKLF-like MARVEL transmembrane domain-containing protein 4, CKLFSF4

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26559-1-AP targets CMTM4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23648

  Product name: Recombinant human CMTM4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-82 aa of BC093679

  Sequence: MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFICIETIMACSPCE

• Full Name: CKLF-like MARVEL transmembrane domain containing 4
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC093679
• Gene Symbol: CMTM4
• Gene ID (NCBI): 146223
• RRID: AB_3085882
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IZR5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CMTM4 belongs to the CKLF-like MARVEL transmembrane domain containing (CMTM) family which contain a structurally conserved MAL and related proteins for vesicle trafficking and membrane linking (MARVEL) domain (PMID: 32944388). CMTM4 plays an important role in mediating endothelial barrier function and controlling vascular sprouting (PMID: 30097810). CMTM4 has been reported to be the major regulator of PD-L1 in liver cancer (PMID: 34558800) and play a tumor suppressive role in colorectal cancer (PMID: 31435638).