CNN2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CNN2 Polyclonal antibody (21073-1-AP)

• Featured Product
• KD/KO Validated

CNN2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21073-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

calponin 2, Calponin H2, smooth muscle, CNN2, Neutral calponin

• 

  WB analysis of HeLa using 21073-1-AP

  WB result of CNN2 antibody (21073-1-AP; 1:100000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CNN2 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 21073-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21073-1-AP (CNN2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 21073-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 21073-1-AP (CNN2 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 21073-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 21073-1-AP (CNN2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human hysteromyoma using 21073-1-AP

  Immunohistochemical analysis of paraffin-embedded human hysteromyoma using 21073-1-AP (CNN2 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human hysteromyoma using 21073-1-AP

  Immunohistochemical analysis of paraffin-embedded human hysteromyoma using 21073-1-AP (CNN2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 21073-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using CNN2 antibody (21073-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 21073-1-AP

  Immunofluorescent analysis of HepG2 cells, using CNN2 antibody 21073-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CNN2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells
• Positive IHC detected in: human heart tissue, human hysteromyoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21073-1-AP targets CNN2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15225

  Product name: Recombinant human CNN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 224-309 aa of BC141818

  Sequence: PGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY

• Full Name: calponin 2
• Calculated Molecular Weight: 309 aa, 34 kDa
• Observed Molecular Weight: 34-36 kDa
• GenBank Accession Number: BC141818
• Gene Symbol: CNN2
• Gene ID (NCBI): 1265
• RRID: AB_10695503
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99439
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). Calponin 1 and calponin 2 are predominately expressed in smooth muscle cells and cardiac muscle cells, respectively. Calponin 3 is highly expressed in many tissues including articular cartilage and brain.

Publications

What published studies show

The antibody (catalog no. 21073-1-AP) has 11 total citations across journals including Circulation Research, Current Biology, Molecular Cell Proteomics, Molecular Metabolism, International Journal of Molecular Sciences, Frontiers in Pharmacology, iScience, Pathology Research and Practice, Tumour Biology, International Journal of Cosmetic Science, and eLife. Research fields span cardiovascular biology, oncology (CRC, osteosarcoma, NSCLC, gastric cancer), kidney fibrosis, T-cell immunology, myoepelial differentiation, skin mechanics, and hair cell cytoskeleton regulation.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Circ Res; Mitochondrial Protein Poldip2 Controls VSMC Differentiated Phenotype by O-Linked GlcNAc Transferase-Dependent Inhibition of a Ubiquitin Proteasome System.; Authors - Felipe Paredes
human	WB	Curr Biol; Calponin isoforms define the cell-type-specific organization and dynamics of actomyosin bundles.; Authors - Shrikant B. Kokate ; KO Validated
mouse,rat	WB,IHC	Mol Metab; Calponin 2 harnesses metabolic reprogramming to determine kidney fibrosis; Authors - Yuan Gui ; KD Validated
human	WB	Mol Cell Proteomics; Quantitative Proteomics of Tissue-Infiltrating T Cells From CRC Patients Identified Lipocalin-2 Induces T-Cell Apoptosis and Promotes Tumor Cell Proliferation by Iron Efflux.; Authors - Rui Che
human	WB	Int J Mol Sci; KIF18B Modulates SKP2 Ubiquitination to Promote Aerobic Glycolysis and Osteosarcoma Progression.; Authors - Haonan Liu
rat	WB	Front Pharmacol; Activation of the Cholinergic Anti-inflammatory Pathway Attenuated Angiotension II-Dependent Hypertension and Renal Injury.; Authors - Shu-Jie Wu