CNN2 Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 66244-1-Ig (same clone as 66244-1-PBS)

  WB result of CNN2 antibody (66244-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CNN2 transfected HeLa cells. This data was developed using the same antibody clone with 66244-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66244-1-Ig (same clone as 66244-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66244-1-Ig (CNN2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 66244-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig stomach using 66244-1-Ig (same clone as 66244-1-PBS)

  pig stomach tissue were subjected to SDS PAGE followed by western blot with 66244-1-Ig (CNN2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66244-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-1080 using 66244-1-Ig (same clone as 66244-1-PBS)

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 66244-1-Ig (CNN2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66244-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 66244-1-Ig (same clone as 66244-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 66244-1-Ig (CNN2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66244-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66244-1-Ig (same clone as 66244-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66244-1-Ig (CNN2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66244-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast hyperplasia using 66244-1-Ig (same clone as 66244-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast hyperplasia tissue slide using 66244-1-Ig (CNN2 Antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66244-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast hyperplasia using 66244-1-Ig (same clone as 66244-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast hyperplasia tissue slide using 66244-1-Ig (CNN2 Antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66244-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CNN2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66244-1-PBS

Clone No.1G10F5

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

1G10F5, calponin 2, calponin2, Calponin-2, CNN 2

---

Product Information

66244-1-PBS targets CNN2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23594

  Product name: Recombinant human CNN2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 224-309 aa of BC141818

  Sequence: PGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY

• Full Name: calponin 2
• Calculated Molecular Weight: 309 aa, 34 kDa
• Observed Molecular Weight: 34-36 kDa
• GenBank Accession Number: BC141818
• Gene Symbol: CNN2
• Gene ID (NCBI): 1265
• RRID: AB_2881633
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99439
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). Calponin 1 and calponin 2 are predominately expressed in smooth muscle cells and cardiac muscle cells, respectively. Calponin 3 is highly expressed in many tissues including articular cartilage and brain.