Product Information
66244-1-PBS targets CNN2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, pig samples.
Tested Reactivity | human, pig |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag23594 Product name: Recombinant human CNN2 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 224-309 aa of BC141818 Sequence: PGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY Predict reactive species |
Full Name | calponin 2 |
Calculated Molecular Weight | 309 aa, 34 kDa |
Observed Molecular Weight | 34-36 kDa |
GenBank Accession Number | BC141818 |
Gene Symbol | CNN2 |
Gene ID (NCBI) | 1265 |
RRID | AB_2881633 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q99439 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). Calponin 1 and calponin 2 are predominately expressed in smooth muscle cells and cardiac muscle cells, respectively. Calponin 3 is highly expressed in many tissues including articular cartilage and brain.