CNTF Polyclonal antibody

• 

  IHC staining of human cerebellum using 27342-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 27342-1-AP (CNTF Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human cerebellum using 27342-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 27342-1-AP (CNTF Antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of PC-12 using 27342-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-12 cells using 27342-1-AP (CNTF antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

CNTF Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 27342-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ciliary neurotrophic factor, CNTF, HCNTF

---

Tested Applications

• Positive IHC detected in: human cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-12 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

27342-1-AP targets CNTF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26410

  Product name: Recombinant human CNTF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-80 aa of BC074964

  Sequence: MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAY

• Full Name: ciliary neurotrophic factor
• Calculated Molecular Weight: 200 aa, 23 kDa
• GenBank Accession Number: BC074964
• Gene Symbol: CNTF
• Gene ID (NCBI): 1270
• RRID: AB_2880848
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P26441
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	bioRxiv; Lipid nanoparticle-mediated delivery of mRNA into the mouse and human retina and other ocular tissues; Authors - Cheri Z Chambers
mouse	IF	Transl Vis Sci Technol; Lipid Nanoparticle-Mediated Delivery of mRNA Into the Mouse and Human Retina and Other Ocular Tissues; Authors - Cheri Z Chambers
human	WB,IHC	J Mol Histol; Ciliary neurotrophic factor (CNTF) contributes to pelvic organ prolapse by modulating collagen expression via the JAK2-STAT3 pathway; Authors - Zhonglei Xu