Filter: AllWBIHCIF-P

WB analysis of pig brain using 67089-1-Ig (same clone as 67089-1-PBS)
pig brain tissue were subjected to SDS PAGE followed by western blot with 67089-1-Ig (CNTN2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67089-1-PBS in a different storage buffer formulation.
WB analysis of pig cerebellum using 67089-1-Ig (same clone as 67089-1-PBS)
pig cerebellum tissue were subjected to SDS PAGE followed by western blot with 67089-1-Ig (CNTN2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67089-1-PBS in a different storage buffer formulation.
WB analysis of pig spinal cord using 67089-1-Ig (same clone as 67089-1-PBS)
pig spinal cord tissue were subjected to SDS PAGE followed by western blot with 67089-1-Ig (CNTN2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67089-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 67089-1-Ig (same clone as 67089-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67089-1-Ig (CNTN2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67089-1-PBS in a different storage buffer formulation.
IHC staining of rat brain using 67089-1-Ig (same clone as 67089-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67089-1-Ig (CNTN2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67089-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 67089-1-Ig (same clone as 67089-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67089-1-Ig (CNTN2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67089-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 67089-1-Ig (same clone as 67089-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67089-1-Ig (CNTN2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67089-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 67089-1-Ig (same clone as 67089-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67089-1-Ig (CNTN2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67089-1-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 67089-1-Ig (same clone as 67089-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CNTN2 antibody (67089-1-Ig, Clone: 1D3G5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67089-1-PBS in a different storage buffer formulation.

CNTN2 Monoclonal antibody, PBS Only

Name: CNTN2 Monoclonal antibody, PBS Only
Brand: Proteintech
SKU: 67089-1-PBS

CNTN2 Monoclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 67089-1-PBS

Clone No.1D3G5

Review Product

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, pig

Applications

IHC, IF-P, Indirect ELISA

Synonyms

1D3G5, Axonin 1, AXT, Contactin2, Contactin-2

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67089-1-PBS targets CNTN2 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, pig samples.

Tested Reactivity	human, mouse, pig
Host / Isotype	Mouse / IgG2b
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag28301 Product name: Recombinant human CNTN2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 865-943 aa of NM_005076 Sequence: MRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESA Predict reactive species
Full Name	contactin 2 (axonal)
Calculated Molecular Weight	113 kDa
Observed Molecular Weight	113-135 kDa
GenBank Accession Number	NM_005076
Gene Symbol	CNTN2
Gene ID (NCBI)	6900
RRID	AB_2918481
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q02246
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Contactin-2 (CNTN2), also known as CNTN2 or axonal glycoprotein TAG-1, is a cell adhesion molecule anchored within the cell membrane that is a member of the immunoglobulin family. It is reported to be transiently expressed in specific neurons during the fetal period (PMID: 27621318, 29777776). CNTN2 consists of six Ig domains followed by four fibronectin domains, and it is tethered to the cell surface by a glycosylphosphatidylinositol anchor. CNTN2 levels may reflect impairment of brain development and indirectly brain iron stores, which are likely deficient in infants of maternal IDA or chronic hypoxic states like IDMs (PMID: 26718491).