CNTN2 Monoclonal antibody, PBS Only

• 

  WB analysis of pig brain using 67089-1-Ig (same clone as 67089-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67089-1-Ig (CNTN2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67089-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67089-1-Ig (same clone as 67089-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67089-1-Ig (CNTN2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67089-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig cerebellum using 67089-1-Ig (same clone as 67089-1-PBS)

  pig cerebellum tissue were subjected to SDS PAGE followed by western blot with 67089-1-Ig (CNTN2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67089-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig spinal cord using 67089-1-Ig (same clone as 67089-1-PBS)

  pig spinal cord tissue were subjected to SDS PAGE followed by western blot with 67089-1-Ig (CNTN2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67089-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67089-1-Ig (same clone as 67089-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67089-1-Ig (CNTN2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67089-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67089-1-Ig (same clone as 67089-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67089-1-Ig (CNTN2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67089-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67089-1-Ig (same clone as 67089-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67089-1-Ig (CNTN2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67089-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67089-1-Ig (same clone as 67089-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67089-1-Ig (CNTN2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67089-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 67089-1-Ig (same clone as 67089-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CNTN2 antibody (67089-1-Ig, Clone: 1D3G5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67089-1-PBS in a different storage buffer formulation.

CNTN2 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67089-1-PBS

Clone No.1D3G5

Host / Isotype

Mouse / IgG2b

Reactivity

Human, pig, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

Axonal glycoprotein TAG 1, Axonin 1, AXT, CNTN2, Contactin 2, contactin 2 (axonal), DKFZp781D102, FLJ42746, TAG 1, TAG1, TAX, TAX 1, TAX1

---

Product Information

67089-1-PBS targets CNTN2 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with Human, pig, mouse samples.

• Tested Reactivity: Human, pig, mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28301

  Product name: Recombinant human CNTN2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 865-943 aa of NM_005076

  Sequence: MRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESA

• Full Name: contactin 2 (axonal)
• Calculated Molecular Weight: 113 kDa
• Observed Molecular Weight: 113-135 kDa
• GenBank Accession Number: NM_005076
• Gene Symbol: CNTN2
• Gene ID (NCBI): 6900
• RRID: AB_2918481
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q02246
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.