CNTN2 Monoclonal antibody

• 

  WB analysis of pig brain using 67089-1-Ig

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67089-1-Ig (CNTN2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig cerebellum using 67089-1-Ig

  pig cerebellum tissue were subjected to SDS PAGE followed by western blot with 67089-1-Ig (CNTN2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig spinal cord using 67089-1-Ig

  pig spinal cord tissue were subjected to SDS PAGE followed by western blot with 67089-1-Ig (CNTN2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 67089-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67089-1-Ig (CNTN2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 67089-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67089-1-Ig (CNTN2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 67089-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67089-1-Ig (CNTN2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 67089-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67089-1-Ig (CNTN2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 67089-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67089-1-Ig (CNTN2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 67089-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CNTN2 antibody (67089-1-Ig, Clone: 1D3G5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

CNTN2 Monoclonal Antibody for IHC, IF-P, ELISA

Cat No. 67089-1-Ig

Clone No.1D3G5

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, pig

Applications

IHC, IF-P, ELISA

Synonyms

1D3G5, Axonin 1, AXT, Contactin2, Contactin-2

---

Tested Applications

• Positive IHC detected in: mouse brain tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67089-1-Ig targets CNTN2 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28301

  Product name: Recombinant human CNTN2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 865-943 aa of NM_005076

  Sequence: MRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESA

• Full Name: contactin 2 (axonal)
• Calculated Molecular Weight: 113 kDa
• Observed Molecular Weight: 113-135 kDa
• GenBank Accession Number: NM_005076
• Gene Symbol: CNTN2
• Gene ID (NCBI): 6900
• RRID: AB_2918481
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q02246
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Contactin-2 (CNTN2), also known as CNTN2 or axonal glycoprotein TAG-1, is a cell adhesion molecule anchored within the cell membrane that is a member of the immunoglobulin family. It is reported to be transiently expressed in specific neurons during the fetal period (PMID: 27621318, 29777776). CNTN2 consists of six Ig domains followed by four fibronectin domains, and it is tethered to the cell surface by a glycosylphosphatidylinositol anchor. CNTN2 levels may reflect impairment of brain development and indirectly brain iron stores, which are likely deficient in infants of maternal IDA or chronic hypoxic states like IDMs (PMID: 26718491).