Collagen Type I Polyclonal antibody

The Collagen Type I polyclonal antibody (14695-1-AP) is one of the most highly cited Collagen Type I antibodies in the market. It is suitable for WB, IHC, IF-P, FC (Intra), IP, ELISA and has been referenced in over 1,331 publications.

Cat No. 14695-1-AP
Publications(1331)

Host / Isotype

Rabbit / IgG

Reactivity

human, pig and More (8)

Applications

WB, IHC, IF-P, FC (Intra), IP, CoIP, ELISA

COL1, COL1A2, Alpha-2 type I collagen, col I, Collagen alpha 2(I) chain

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU-87 MG cells, human placenta tissue, MG-63 cells, pig skin tissue, Saos-2 cells
Positive IP detected inU-87 MG cells
Positive IHC detected inhuman colon tissue, human breast cancer tissue, human oesophagus cancer tissue, human placenta tissue, human skin cancer tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse skin tissue
Positive FC (Intra) detected inSW480 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14695-1-AP targets Collagen Type I in WB, IHC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Cited Reactivityhuman, mouse, rat, pig, rabbit, canine, chicken, bovine, toad, duck
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6281

Product name: Recombinant human COL1A2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1017-1366 aa of BC054498

Sequence: RGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK

Predict reactive species
Full Name collagen, type I, alpha 2
Calculated Molecular Weight 1366 aa, 130 kDa
Observed Molecular Weight130-160 kDa
GenBank Accession NumberBC054498
Gene Symbol COL1A2
Gene ID (NCBI) 1278
RRIDAB_2082037
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08123
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Type I collagen, the major structural component of connective tissues such as skin, tendon and bone, is the most abundant and widely expressed collagen in humans (PMID: 7620364; 8645190; 9016532). Type I collagen is a heterotrimer comprising one alpha 2(I) and two alpha 1(I) chains which are encoded by the unlinked loci COL1A2 and COL1A1 respectively. Mutations in COL1A2 gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. This antibody raised against 1017-1366 aa of human pro-alpha 2 chain of type l collagen can recognize collagen alpha 2(1) chain and C-terminal propeptide of pro-alpha 2(1) chain.

Protocols

Product Specific Protocols
FC protocol for Collagen Type I antibody 14695-1-APDownload protocol
IF protocol for Collagen Type I antibody 14695-1-APDownload protocol
IHC protocol for Collagen Type I antibody 14695-1-APDownload protocol
IP protocol for Collagen Type I antibody 14695-1-APDownload protocol
WB protocol for Collagen Type I antibody 14695-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cancer Cell

Single-cell multi-stage spatial evolutional map of esophageal carcinogenesis

Authors - Jiang Chang
rabbitIF

Adv Mater

A Superparamagnetic Composite Hydrogel Scaffold as in Vivo Dynamic Monitorable Theranostic Platform for Osteoarthritis Regeneration

Authors - Mayifei Rong
mouseWB

Gastroenterology

Pancreatic acinar cells-derived sphingosine-1-phosphate contributes to fibrosis of chronic pancreatitis via inducing autophagy and activation of pancreatic stellate cells

Authors - Decai Wang
ratIF

Adv Mater

Acid-Induced in Situ Phase Separation and Percolation for Constructing Bi-Continuous Phase Hydrogel Electrodes With Motion-Insensitive Property

Authors - Qingquan Han
mouseWB

Gut

Histone methyltransferase Suv39h1 regulates hepatic stellate cell activation and is targetable in liver fibrosis

Authors - Ming Kong
humanWB

Bioact Mater

Bioengineered platelet nanoplatform enables renal-targeted dexamethasone delivery for chronic nephritis therapy with dual anti-inflammatory/anti-fibrotic effects and minimized systemic toxicity

Authors - Lingling Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

John (Verified Customer) (01-30-2026)

Good collagen antibody for IF. Strong signal. Worked well with calcium phosphate cement cultured cells (MC3T3-E1).

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:400
  • Cell Tissue Type: MC3T3-E1 pre-osteoblast
Collagen Type I Antibody Immunofluorescence validation (1:400 dilution) in MC3T3-E1 pre-osteoblast (Cat no:14695-1-AP)
FH

p (Verified Customer) (09-23-2024)

Excellent

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: HEK
Collagen Type I Antibody Western Blot validation (1000 dilution) in HEK (Cat no:14695-1-AP)
FH

Brice-Emmanuel (Verified Customer) (10-12-2023)

I have 2 bands in 70 kDa

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Mouse Heart Tissue
Collagen Type I Antibody Western Blot validation (1/1000 dilution) in Mouse Heart Tissue (Cat no:14695-1-AP)
FH

S (Verified Customer) (03-20-2023)

Excellent Antibody!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: fibroblast
Collagen Type I Antibody Western Blot validation (1000 dilution) in fibroblast (Cat no:14695-1-AP)
FH

Balawant Kumar (Verified Customer) (12-20-2022)

antibody is working great. I have used this antibody for mice colon tissue and colon cancer cell line

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: colon tissue and colon cancer cell line (caco2, HCT116)
FH

PK (Verified Customer) (07-08-2022)

Very Good

  • Applications: Western Blot
  • Cell Tissue Type: Fibroblast
Collagen Type I Antibody Western Blot validation ( dilution) in Fibroblast (Cat no:14695-1-AP)
FH

Ren Jie (Verified Customer) (06-22-2022)

Very strong signal for collagen I, needs stringent wash conditions to minimize ladder staining in western blot

  • Applications: Western Blot, Other
  • Primary Antibody Dilution: 1:1000
FH

S (Verified Customer) (12-01-2021)

Excellent

  • Applications: Western Blot
  • Cell Tissue Type: LUNG FIBROBLASTS
Collagen Type I Antibody Western Blot validation ( dilution) in LUNG FIBROBLASTS (Cat no:14695-1-AP)
FH

Hala (Verified Customer) (02-23-2021)

very good

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
FH

Eistine (Verified Customer) (05-31-2019)

The antibody works pretty good

  • Applications: Immunofluorescence,
Loading...
||
New chat

Able

正在加载,请稍候...