Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Collagen Type III (N-terminal) Polyclonal antibody

Collagen Type III (N-terminal) Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, IP, ELISA

Cat No. 22734-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (6)

Applications

WB, IHC, IF-P, IF-Fro, IP, CoIP, ELISA

COL3, COL3A1, Collagen alpha 1(III) chain, Collagen alpha-1(III) chain, Collagen Type III

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
HRP
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse skin tissue, rat skin tissue
Positive IP detected inmouse skin tissue
Positive IHC detected inhuman hepatocirrhosis tissue, human pancreas cancer tissue, mouse liver tissue, mouse kidney tissue, human colon tissue, human skin cancer tissue, mouse heart tissue, mouse colon tissue, human skin tissue, human malignant melanoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman colon tissue
Positive IF-Fro detected inmouse colon tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:300-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22734-1-AP targets Collagen Type III (N-terminal) in WB, IHC, IF-P, IF-Fro, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit, canine, chicken, bovine, hamster
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18658

Product name: Recombinant human COL3A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-152 aa of BC028178

Sequence: QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYS

Predict reactive species
Full Name collagen, type III, alpha 1
Calculated Molecular Weight 1466 aa, 139 kDa
Observed Molecular Weight 140-180 kDa
GenBank Accession NumberBC028178
Gene Symbol COL3A1
Gene ID (NCBI) 1281
RRIDAB_2879158
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02461
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Type III collagen is a fibrillar forming collagen comprising three α1(III) chains and is expressed in early embryos and throughout embryogenesis (PMID: 9050868). In the adult, type III collagen is a major component of the extracellular matrix in a variety of internal organs and skin. It occurs in most soft connective tissues along with type I collagen (PMID: 2445760). COL3A1 gene encodes type III procollagen. Mutations in this gene are associated with Ehlers-Danlos syndrome types IV, and with aortic and arterial aneurysms (PMID: 10706896; 2243125; 18389341). This antibody raised against 24-152 aa of prepro α1 (III) chain of human type III procollagen detects type III procollagen at 140-180 kDa and also in some lysates reveals a 70-kDa band which has been reported and may represent a cleaved form of type III procollagen (PMID: 17424834; 19648160; 22802960).

Protocols

Product Specific Protocols
IF protocol for Collagen Type III (N-terminal) antibody 22734-1-APDownload protocol
IHC protocol for Collagen Type III (N-terminal) antibody 22734-1-APDownload protocol
IP protocol for Collagen Type III (N-terminal) antibody 22734-1-APDownload protocol
WB protocol for Collagen Type III (N-terminal) antibody 22734-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cancer Cell

Single-cell multi-stage spatial evolutional map of esophageal carcinogenesis

Authors - Jiang Chang
ratWB

Cell Metab

Sphingolipid metabolism controls mammalian heart regeneration

Authors - Xiaoqian Ji
human,mouseIF

Nat Aging

Single-cell and spatial RNA sequencing identify divergent microenvironments and progression signatures in early- versus late-onset prostate cancer

Authors - Yifei Cheng
humanWB

Adv Sci (Weinh)

LIMA1 O-GlcNAcylation Promotes Hepatic Lipid Deposition through Inducing β-catenin-Regulated FASn Expression in Metabolic Dysfunction-Associated Steatotic Liver Disease

Authors - Fuji Yang
mouseIHC

Acta Pharm Sin B

SMYD3-PARP16 axis accelerates unfolded protein response and mediates neointima formation.

Authors - Fen Long

Sci Adv

Designer cellular spheroids with DNA origami for drug screening

Authors - Jiayi Wei

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Guennec (Verified Customer) (10-12-2023)

I have 2 bands at 70 KDa.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Mouse Heart Tissue
Collagen Type III (N-terminal) Antibody Western Blot validation (1/1000 dilution) in Mouse Heart Tissue (Cat no:22734-1-AP)
FH

Sarah-Eve (Verified Customer) (02-19-2023)

Works well. One band observed at 180 kDa.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: Human right ventricular fibroblasts
FH

Gayatri (Verified Customer) (06-10-2022)

Good signal but inexplicable molecular weight. Observe bands at 70 kDa instead of expected 140-180 kDa although this product is validated for Rat. Observed in both rat heart and tail lysates.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Rat Heart Tissue
FH

Yuki (Verified Customer) (03-30-2022)

Works well for IF application and presented with intense staining

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: skin cells
Collagen Type III (N-terminal) Antibody Immunohistochemistry validation (1:50 dilution) in skin cells (Cat no:22734-1-AP)
FH

Ryan (Verified Customer) (04-20-2018)

Antibody worked well for IF application and presented with intense staining of both medial and adventitial collagen in artery sections

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:400
  • Cell Tissue Type: paraffin carotid artery section
Collagen Type III (N-terminal) Antibody Immunofluorescence validation (1:400 dilution) in paraffin carotid artery section (Cat no:22734-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...