Tested Applications
| Positive WB detected in | mouse skin tissue, rat skin tissue |
| Positive IP detected in | mouse skin tissue |
| Positive IHC detected in | human hepatocirrhosis tissue, human pancreas cancer tissue, mouse liver tissue, mouse kidney tissue, human colon tissue, human skin cancer tissue, mouse heart tissue, mouse colon tissue, human skin tissue, human malignant melanoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human colon tissue |
| Positive IF-Fro detected in | mouse colon tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:300-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 426 publications below |
| IHC | See 183 publications below |
| IF | See 115 publications below |
| CoIP | See 1 publications below |
Product Information
22734-1-AP targets Collagen Type III (N-terminal) in WB, IHC, IF-P, IF-Fro, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit, canine, chicken, bovine, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18658 Product name: Recombinant human COL3A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-152 aa of BC028178 Sequence: QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYS Predict reactive species |
| Full Name | collagen, type III, alpha 1 |
| Calculated Molecular Weight | 1466 aa, 139 kDa |
| Observed Molecular Weight | 140-180 kDa |
| GenBank Accession Number | BC028178 |
| Gene Symbol | COL3A1 |
| Gene ID (NCBI) | 1281 |
| RRID | AB_2879158 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P02461 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Type III collagen is a fibrillar forming collagen comprising three α1(III) chains and is expressed in early embryos and throughout embryogenesis (PMID: 9050868). In the adult, type III collagen is a major component of the extracellular matrix in a variety of internal organs and skin. It occurs in most soft connective tissues along with type I collagen (PMID: 2445760). COL3A1 gene encodes type III procollagen. Mutations in this gene are associated with Ehlers-Danlos syndrome types IV, and with aortic and arterial aneurysms (PMID: 10706896; 2243125; 18389341). This antibody raised against 24-152 aa of prepro α1 (III) chain of human type III procollagen detects type III procollagen at 140-180 kDa and also in some lysates reveals a 70-kDa band which has been reported and may represent a cleaved form of type III procollagen (PMID: 17424834; 19648160; 22802960).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Collagen Type III (N-terminal) antibody 22734-1-AP | Download protocol |
| IHC protocol for Collagen Type III (N-terminal) antibody 22734-1-AP | Download protocol |
| IP protocol for Collagen Type III (N-terminal) antibody 22734-1-AP | Download protocol |
| WB protocol for Collagen Type III (N-terminal) antibody 22734-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Aging Single-cell and spatial RNA sequencing identify divergent microenvironments and progression signatures in early- versus late-onset prostate cancer | ||
Adv Sci (Weinh) LIMA1 O-GlcNAcylation Promotes Hepatic Lipid Deposition through Inducing β-catenin-Regulated FASn Expression in Metabolic Dysfunction-Associated Steatotic Liver Disease | ||
Acta Pharm Sin B SMYD3-PARP16 axis accelerates unfolded protein response and mediates neointima formation. | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Guennec (Verified Customer) (10-12-2023) | I have 2 bands at 70 KDa.
|
FH Sarah-Eve (Verified Customer) (02-19-2023) | Works well. One band observed at 180 kDa.
|
FH Gayatri (Verified Customer) (06-10-2022) | Good signal but inexplicable molecular weight. Observe bands at 70 kDa instead of expected 140-180 kDa although this product is validated for Rat. Observed in both rat heart and tail lysates.
|
FH Yuki (Verified Customer) (03-30-2022) | Works well for IF application and presented with intense staining
![]() |
FH Ryan (Verified Customer) (04-20-2018) | Antibody worked well for IF application and presented with intense staining of both medial and adventitial collagen in artery sections
|


























































