COPZ1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86014-1-RR (same clone as 86014-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86014-1-RR (COPZ1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86014-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 86014-1-RR (same clone as 86014-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using COPZ1 antibody (86014-1-RR, Clone: 250388F3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86014-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86014-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86014-1-RR against Human COPZ1 were performed. The affinity constant is 1.45 nM.

COPZ1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86014-1-PBS

Clone No.250388F3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, monkey

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

CGI 120, CGI-120, Coatomer subunit zeta 1, Coatomer subunit zeta-1, COPZ

---

Product Information

86014-1-PBS targets COPZ1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, monkey samples.

• Tested Reactivity: human, mouse, monkey
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14234

  Product name: Recombinant human COPZ1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 31-84 aa of BC002849

  Sequence: YDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSY

• Full Name: coatomer protein complex, subunit zeta 1
• Calculated Molecular Weight: 177 aa, 20 kDa
• Observed Molecular Weight: 15-20 kDa
• GenBank Accession Number: BC002849
• Gene Symbol: COPZ1
• Gene ID (NCBI): 22818
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P61923
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.