Tested Applications
| Positive WB detected in | HeLa cells, RAW 264.7 cells, COS-7 cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
86014-1-RR targets COPZ1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, monkey samples.
| Tested Reactivity | human, mouse, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag14234 Product name: Recombinant human COPZ1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 31-84 aa of BC002849 Sequence: YDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSY Predict reactive species |
| Full Name | coatomer protein complex, subunit zeta 1 |
| Calculated Molecular Weight | 177 aa, 20 kDa |
| Observed Molecular Weight | 15-20 kDa |
| GenBank Accession Number | BC002849 |
| Gene Symbol | COPZ1 |
| Gene ID (NCBI) | 22818 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P61923 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for COPZ1 antibody 86014-1-RR | Download protocol |
| WB protocol for COPZ1 antibody 86014-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





