COTL1 Monoclonal antibody

• 

  WB analysis of A431 using 60237-1-Ig

  A431 cells were subjected to SDS PAGE followed by western blot with 60237-1-Ig (COTL1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 60237-1-Ig

  WB result of COTL1 antibody (60237-1-Ig; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-COTL1 transfected HeLa cells.

• 

  WB analysis of human peripheral blood platelets using 60237-1-Ig

  human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 60237-1-Ig (COTL1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of fetal human brain using 60237-1-Ig

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 60237-1-Ig (COTL1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 60237-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 60237-1-Ig (COTL1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 60237-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 60237-1-Ig (COTL1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 60237-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using COTL1 antibody (60237-1-Ig, Clone: 4A3D9 ) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

COTL1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 60237-1-Ig

Clone No.4A3D9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CLP, Coactosin like protein, COTL1

---

Tested Applications

• Positive WB detected in: A431 cells, fetal human brain tissue, human peripheral blood platelets, HeLa cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60237-1-Ig targets COTL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1230

  Product name: Recombinant human COTL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-142 aa of BC010884

  Sequence: MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE

• Full Name: coactosin-like 1 (Dictyostelium)
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 14-16 kDa
• GenBank Accession Number: BC010884
• Gene Symbol: COTL1
• Gene ID (NCBI): 23406
• RRID: AB_2881360
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14019
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COTL1, also named as CLP, binds to F-actin in a calcium-independent manner. And it has no direct effect on actin depolymerization.