COXIV Polyclonal antibody

• Validation Data Gallery
• Proteintech vs. Other Vendors

• 

  WB analysis using 11242-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11242-1-AP (COXIV antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 11242-1-AP

  WB result of COXIV antibody (11242-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-COXIV transfected HepG2 cells.

• 

  WB analysis using 11242-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11242-1-AP (COXIV antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 11242-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 11242-1-AP (COXIV Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 11242-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 11242-1-AP (COXIV antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse skeletal muscle using 11242-1-AP

  IP result of anti-COXIV (IP:11242-1-AP, 3ug; Detection:11242-1-AP 1:1000) with mouse skeletal muscle tissue lysate 3500ug.

• 

  IHC staining of human prostate cancer using 11242-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11242-1-AP (COXIV antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 11242-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11242-1-AP (COXIV antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human heart using 11242-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 11242-1-AP (COXIV antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human heart using 11242-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 11242-1-AP (COXIV antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human pancreas cancer using 11242-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11242-1-AP (COXIV antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 11242-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11242-1-AP (COXIV antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 11242-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using COXIV antibody (11242-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

"COXIV Antibodies" Comparison

View side-by-side comparison of COXIV antibodies from other vendors to find the one that best suits your research needs.

Compare now

• Featured Product
• KD/KO Validated

The COXIV polyclonal antibody (11242-1-AP) is one of the most highly cited COXIV antibodies in the market. It is suitable for WB, IHC, IF/ICC, IP, ELISA and has been referenced in over 498 publications.

Cat No. 11242-1-AP

Publications(498)

Reviews (6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

Synonyms

COX4I1, COX IV-1, COX4, Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, rat liver tissue, rat brain tissue, MCF-7 cells, NIH/3T3 cells, Jurkat cells, mouse skeletal muscle tissue
• Positive IP detected in: mouse skeletal muscle tissue
• Positive IHC detected in: human prostate cancer tissue, human pancreas cancer tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:20000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 449 publications below
• IHC: See 9 publications below
• IF: See 54 publications below
• IP: See 3 publications below
• ChIP: See 1 publications below

Product Information

11242-1-AP targets COXIV in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, canine, bovine, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1640

  Product name: Recombinant human COXIV protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-169 aa of BC021236

  Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

• Full Name: cytochrome c oxidase subunit IV isoform 1
• Calculated Molecular Weight: 19.6 kDa
• Observed Molecular Weight: 17-18 kDa
• GenBank Accession Number: BC021236
• Gene Symbol: COX IV
• Gene ID (NCBI): 1327
• RRID: AB_2085278
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13073
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COX4I1, also named as COX4 and COXIV-1, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX4I1 is a marker for mitochondria. It has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues. COX4I1 is commonly used as a loading control. This antibody was generated against full length COX4I1 protein and cross reacts with COX4I2.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Res; Mitochondria-localized cGAS suppresses ferroptosis to promote cancer progression; Authors - Shiqiao Qiu
	WB	Cell Res; Nonenzymatic lysine D-lactylation induced by glyoxalase II substrate SLG dampens inflammatory immune responses; Authors - Qihang Zhao
mouse,human	WB,IF	Immunity; Excessive Polyamine Generation in Keratinocytes Promotes Self-RNA Sensing by Dendritic Cells in Psoriasis.; Authors - Fangzhou Lou
mouse	WB	Nat Metab; Time of exercise differentially impacts bone growth in mice; Authors - Shaoling Yu
human	WB	Cell Metab; Tyrosine Phosphorylation of Mitochondrial Creatine Kinase 1 Enhances a Druggable Tumor Energy Shuttle Pathway.; Authors - Kiran Kurmi
mouse	WB	Nat Cell Biol; AIDA directly connects sympathetic innervation to adaptive thermogenesis by UCP1.; Authors - Meng Shi

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Matthieu (Verified Customer) (09-24-2025)

Slightly diffuse band at the expected size

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: human fibroblasts

FH

Vignesh (Verified Customer) (09-03-2025)

Good product with good specificity.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: HEK293 cells

FH

Jimmy (Verified Customer) (02-27-2024)

Strong signal in primary human cell fractions.

• Applications: Western Blot

FH

Maria (Verified Customer) (08-17-2021)

Good ab, works well 1:1000 in BSA 3% O/N 4ºC incubation.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: human primary fibroblasts

COXIV Antibody Western Blot validation (1:1000 dilution) in human primary fibroblasts (Cat no:11242-1-AP)

FH

Mohammed (Verified Customer) (08-19-2020)

Very strong staining in the midpiece of the sperm tail.

• Applications: Immunofluorescence
• Primary Antibody Dilution: (1:200)
• Cell Tissue Type: Isolated sperm

FH

SITING (Verified Customer) (07-13-2020)

THIS IS A GOOD ANTIBODY, CAN SEE CLEAR BAND

• Applications: Western Blot,

COXIV Antibody Western Blot, validation ( dilution) in (Cat no:11242-1-AP)