Tested Applications
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-11242 targets COXIV in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1640 Product name: Recombinant human COXIV protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC021236 Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK Predict reactive species |
| Full Name | cytochrome c oxidase subunit IV isoform 1 |
| Calculated Molecular Weight | 19.6 kDa |
| Observed Molecular Weight | 17-18 kDa |
| GenBank Accession Number | BC021236 |
| Gene Symbol | COX IV |
| Gene ID (NCBI) | 1327 |
| RRID | AB_2919017 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P13073 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
COX4I1, also named as COX4 and COXIV-1, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX4I1 is a marker for mitochondria. It has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues. COX4I1 is commonly used as a loading control. This antibody was generated against full length COX4I1 protein and cross reacts with COX4I2.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 COXIV antibody CL488-11242 | Download protocol |
| IF protocol for CL Plus 488 COXIV antibody CL488-11242 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



