Filter:
  • Western Blot (WB) analysis of various lysates using COXIV Polyclonal antibody (11242-1-AP)

    WB analysis using 11242-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 11242-1-AP (COXIV antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of various lysates using COXIV Polyclonal antibody (11242-1-AP)

    WB analysis using 11242-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 11242-1-AP (COXIV antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of HepG2 cells using COXIV Polyclonal antibody (11242-1-AP)

    WB analysis of HepG2 using 11242-1-AP

    WB result of COXIV antibody (11242-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-COXIV transfected HepG2 cells.

  • Western Blot (WB) analysis of various lysates using COXIV Polyclonal antibody (11242-1-AP)

    WB analysis using 11242-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 11242-1-AP (COXIV antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of rat brain tissue using COXIV Polyclonal antibody (11242-1-AP)

    WB analysis of rat brain using 11242-1-AP

    rat brain tissue were subjected to SDS PAGE followed by western blot with 11242-1-AP (COXIV Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of rat liver tissue using COXIV Polyclonal antibody (11242-1-AP)

    WB analysis of rat liver using 11242-1-AP

    rat liver tissue were subjected to SDS PAGE followed by western blot with 11242-1-AP (COXIV antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  • Immunoprecipitation (IP) experiment of mouse skeletal muscle tissue using COXIV Polyclonal antibody (11242-1-AP)

    IP experiment of mouse skeletal muscle using 11242-1-AP

    IP result of anti-COXIV (IP:11242-1-AP, 3ug; Detection:11242-1-AP 1:1000) with mouse skeletal muscle tissue lysate 3500ug.

  • Immunohistochemistry (IHC) staining of human prostate cancer tissue using COXIV Polyclonal antibody (11242-1-AP)

    IHC staining of human prostate cancer using 11242-1-AP

    Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11242-1-AP (COXIV antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human prostate cancer tissue using COXIV Polyclonal antibody (11242-1-AP)

    IHC staining of human prostate cancer using 11242-1-AP

    Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11242-1-AP (COXIV antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human heart tissue using COXIV Polyclonal antibody (11242-1-AP)

    IHC staining of human heart using 11242-1-AP

    Immunohistochemical analysis of paraffin-embedded human heart using 11242-1-AP (COXIV antibody) at dilution of 1:50 (under 10x lens).

  • Immunohistochemistry (IHC) staining of human heart tissue using COXIV Polyclonal antibody (11242-1-AP)

    IHC staining of human heart using 11242-1-AP

    Immunohistochemical analysis of paraffin-embedded human heart using 11242-1-AP (COXIV antibody) at dilution of 1:50 (under 40x lens).

  • Immunohistochemistry (IHC) staining of human pancreas cancer tissue using COXIV Polyclonal antibody (11242-1-AP)

    IHC staining of human pancreas cancer using 11242-1-AP

    Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11242-1-AP (COXIV antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human pancreas cancer tissue using COXIV Polyclonal antibody (11242-1-AP)

    IHC staining of human pancreas cancer using 11242-1-AP

    Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11242-1-AP (COXIV antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of HepG2 cells using COXIV Polyclonal antibody (11242-1-AP)

    IF Staining of HepG2 using 11242-1-AP

    Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using COXIV antibody (11242-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

"COXIV Antibodies" Comparison

View side-by-side comparison of COXIV antibodies from other vendors to find the one that best suits your research needs.
  • Featured Product
  • KD/KO Validated

COXIV Polyclonal antibody

The COXIV polyclonal antibody (11242-1-AP) is one of the most highly cited COXIV antibodies in the market. It is suitable for WB, IHC, IF/ICC, IP, ELISA and has been referenced in over 519 publications.

Cat No. 11242-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

COX4I1, COX IV-1, COX4, Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, HepG2 cells, rat brain tissue, rat liver tissue, mouse heart tissue, mouse liver tissue, mouse lung tissue, Jurkat cells, NIH/3T3 cells, mouse skeletal muscle tissue, MCF-7 cells
Positive IP detected inmouse skeletal muscle tissue
Positive IHC detected inhuman prostate cancer tissue, human pancreas cancer tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:20000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11242-1-AP targets COXIV in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, canine, bovine, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1640

Product name: Recombinant human COXIV protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-169 aa of BC021236

Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

Predict reactive species
Full Name cytochrome c oxidase subunit IV isoform 1
Calculated Molecular Weight19.6 kDa
Observed Molecular Weight 17-18 kDa
GenBank Accession NumberBC021236
Gene Symbol COX IV
Gene ID (NCBI) 1327
RRIDAB_2085278
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP13073
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COX4I1, also named as COX4 and COXIV-1, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX4I1 is a marker for mitochondria. It has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues. COX4I1 is commonly used as a loading control. This antibody was generated against full length COX4I1 protein and cross reacts with COX4I2.

Protocols

Product Specific Protocols
IF protocol for COXIV antibody 11242-1-APDownload protocol
IHC protocol for COXIV antibody 11242-1-APDownload protocol
IP protocol for COXIV antibody 11242-1-APDownload protocol
WB protocol for COXIV antibody 11242-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Cell Res

Nonenzymatic lysine D-lactylation induced by glyoxalase II substrate SLG dampens inflammatory immune responses

Authors - Qihang Zhao
humanWB

Cell Res

Mitochondria-localized cGAS suppresses ferroptosis to promote cancer progression

Authors - Shiqiao Qiu
mouse,humanWB,IF

Immunity

Excessive Polyamine Generation in Keratinocytes Promotes Self-RNA Sensing by Dendritic Cells in Psoriasis.

Authors - Fangzhou Lou
mouseWB

Nat Metab

Time of exercise differentially impacts bone growth in mice

Authors - Shaoling Yu
humanWB

Cell Metab

Tyrosine Phosphorylation of Mitochondrial Creatine Kinase 1 Enhances a Druggable Tumor Energy Shuttle Pathway.

Authors - Kiran Kurmi
mouseWB

Nat Cell Biol

AIDA directly connects sympathetic innervation to adaptive thermogenesis by UCP1.

Authors - Meng Shi

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Matthieu (Verified Customer) (09-24-2025)

Slightly diffuse band at the expected size

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: human fibroblasts
FH

Vignesh (Verified Customer) (09-03-2025)

Good product with good specificity.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: HEK293 cells
FH

Jimmy (Verified Customer) (02-27-2024)

Strong signal in primary human cell fractions.

  • Applications: Western Blot
FH

Maria (Verified Customer) (08-17-2021)

Good ab, works well 1:1000 in BSA 3% O/N 4ºC incubation.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: human primary fibroblasts
COXIV Antibody Western Blot validation (1:1000 dilution) in human primary fibroblasts (Cat no:11242-1-AP)
FH

Mohammed (Verified Customer) (08-19-2020)

Very strong staining in the midpiece of the sperm tail.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: (1:200)
  • Cell Tissue Type: Isolated sperm
FH

SITING (Verified Customer) (07-13-2020)

THIS IS A GOOD ANTIBODY, CAN SEE CLEAR BAND

  • Applications: Western Blot,
COXIV Antibody Western Blot, validation ( dilution) in (Cat no:11242-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...