CD35 Monoclonal antibody

• 

  IHC staining of human tonsillitis using 68033-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 68033-1-Ig (CD35 antibody) at dilution of 1:1100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 68033-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 68033-1-Ig (CD35 antibody) at dilution of 1:1100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 68033-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 68033-1-Ig (CD35 antibody) at dilution of 1:3000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human appendicitis using 68033-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human appendicitis tissue using CD35 antibody (68033-1-Ig, Clone: 1B8E6 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of human appendicitis using 68033-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human appendicitis tissue using CR1 antibody (68033-1-Ig, Clone: 1B8E6 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of human tonsillitis using 68033-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using CD35 antibody (68033-1-Ig, Clone: 1B8E6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD35 Monoclonal Antibody for IHC, IF-P, ELISA

Cat No. 68033-1-Ig

Clone No.1B8E6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC, IF-P, ELISA

Synonyms

C3b/C4b receptor, C3BR, Complement receptor type 1, CR1, KN

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue, human appendicitis tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:550-1:2200
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68033-1-Ig targets CD35 in IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30268

  Product name: Recombinant human CR1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1740-1971 aa of NM_000573

  Sequence: DEGFRLKGRSASHCVLAGMKALWNSSVPVCEQIFCPNPPAILNGRHTGTPFGDIPYGKEISYACDTHPDRGMTFNLIGESSIRCTSDPQGNGVWSSPAPRCELSVPAACPHPPKIQNGHYIGGHVSLYLPGMTISYICDPGYLLVGKGFIFCTDQGIWSQLDHYCKEVNCSFPLFMNGISKELEMKKVYHYGDYVTLKCEDGYTLEGSPWSQCQADDRWDPPLAKCTSRTHD

• Full Name: complement component (3b/4b) receptor 1 (Knops blood group)
• Calculated Molecular Weight: 224 kDa
• GenBank Accession Number: NM_000573
• Gene Symbol: CR1
• Gene ID (NCBI): 1378
• ENSEMBL Gene ID: ENSG00000203710
• RRID: AB_2918775
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P17927
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD35, also known as complement receptor type 1 (CR1) or C3b/C4b receptor, is a single-chain glycoprotein consisting of 30 repeating homologous protein domains known as short consensus repeats (~60 amino acids each) followed by transmembrane and cytoplasmic domains (PMID: 8765013). CD35 is variably expressed by granulocytes, monocytes, B cells, some T cells, erythrocytes, follicular dendritic cells, Langerhans cells, and glomerular podocytes (PMID: 19004497). CD35 acts as a receptor for C3b and C4b and plays important roles in the regulation of the complement cascade and clearance of immune complexes. A soluble form of CD35 has been found in plasma (PMID: 3156931). It has been reported that soluble CD35 is produced by a proteolytic cleavage in the C-terminal region of CD35 transmembrane domain (PMID: 9405292).