CoraLite® Plus 488-conjugated CD35 Monoclonal antibody

CD35 Monoclonal Antibody for IF-P
Cat No. CL488-68033
Clone No.1B8E6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF-P

KN, CR1, Complement receptor type 1, C3BR, C3b/C4b receptor

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman appendicitis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68033 targets CD35 in IF-P applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30268

Product name: Recombinant human CR1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1740-1971 aa of NM_000573

Sequence: DEGFRLKGRSASHCVLAGMKALWNSSVPVCEQIFCPNPPAILNGRHTGTPFGDIPYGKEISYACDTHPDRGMTFNLIGESSIRCTSDPQGNGVWSSPAPRCELSVPAACPHPPKIQNGHYIGGHVSLYLPGMTISYICDPGYLLVGKGFIFCTDQGIWSQLDHYCKEVNCSFPLFMNGISKELEMKKVYHYGDYVTLKCEDGYTLEGSPWSQCQADDRWDPPLAKCTSRTHD

Predict reactive species
Full Name complement component (3b/4b) receptor 1 (Knops blood group)
Calculated Molecular Weight 224 kDa
GenBank Accession NumberNM_000573
Gene Symbol CR1
Gene ID (NCBI) 1378
ENSEMBL Gene IDENSG00000203710
RRIDAB_2934612
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP17927
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD35, also known as complement receptor type 1 (CR1) or C3b/C4b receptor, is a single-chain glycoprotein consisting of 30 repeating homologous protein domains known as short consensus repeats (~60 amino acids each) followed by transmembrane and cytoplasmic domains (PMID: 8765013). CD35 is variably expressed by granulocytes, monocytes, B cells, some T cells, erythrocytes, follicular dendritic cells, Langerhans cells, and glomerular podocytes (PMID: 19004497). CD35 acts as a receptor for C3b and C4b and plays important roles in the regulation of the complement cascade and clearance of immune complexes. A soluble form of CD35 has been found in plasma (PMID: 3156931). It has been reported that soluble CD35 is produced by a proteolytic cleavage in the C-terminal region of CD35 transmembrane domain (PMID: 9405292).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CD35 antibody CL488-68033Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...