Tested Applications
Positive IHC detected in | human pancreas tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
12315-1-AP targets CRB3 in IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2968 Product name: Recombinant human CRB3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 15-123 aa of BC018409 Sequence: PFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQFSHAAEARAPQDSKETVQGCLPI Predict reactive species |
Full Name | crumbs homolog 3 (Drosophila) |
Calculated Molecular Weight | 123 aa, 13 kDa |
GenBank Accession Number | BC018409 |
Gene Symbol | CRB3 |
Gene ID (NCBI) | 92359 |
RRID | AB_2877844 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9BUF7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Crumbs is an apical transmembrane protein crucial for epithelial morphogenesis in Drosophila melanogaster embryos. Three isoforms of mammalian Crumbs have been identified, and two have been characterized. Crumbs1 (CRB1) is expressed primarily in the central nervous system, whereas Crumbs3 (CRB3) is mainly expressed in epithelial tissues and skeletal muscles. CRB3 is an N-glycosylated, small transmembrane protein. CRB3 has a conserved cytoplasmic domain containing the two motives GTY and ERLI found in Crumbs, but exhibits a very short extracellular domain without the EGF- and laminin A-like G repeats present in the other Crumbs. Through its cytoplasmic domain and its interactors (e.g., Pals1 and Par6), CRB3 plays a role in apical membrane morphogenesis and tight junction regulation. (PMID: 14718572; 12527193; 15976445)
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for CRB3 antibody 12315-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |