Tested Applications
| Positive WB detected in | rat brain tissue, mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
26848-1-AP targets CRH/CRF in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25226 Product name: Recombinant human CRH protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 53-156 aa of BC011031 Sequence: SEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERRSEE Predict reactive species |
| Full Name | CRH/CRF |
| Calculated Molecular Weight | 21 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC011031 |
| Gene Symbol | CRH |
| Gene ID (NCBI) | 1392 |
| RRID | AB_3085911 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P06850 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CRH, also called CRF or corticoliberin, is a peptide hormone and neurotransmitter involved in the stress response. Marked reduction in this protein has been observed in association with Alzheimer disease. In addition to production in the hypothalamus, this protein is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed in the placenta. In the placenta it is a marker that determines the length of gestation and the timing of parturition and delivery.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CRH/CRF antibody 26848-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Cortical arealization of interneurons defines shared and distinct molecular programs in developing human and macaque brains | ||
Food Res Int Lactobacillus reuteri or Lactobacillus rhamnosus GG intervention facilitates gut barrier function, decreases corticosterone and ameliorates social behavior in LPS-exposed offspring | ||
Int J Biol Macromol An injectable responsive exosome-releasing hydrogel based on sodium alginate restores motor and bladder function by alleviating the injury microenvironment and facilitating distal nerve repair |

