Tested Applications
| Positive WB detected in | HeLa cells, PC-3 cells |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 3 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
| CoIP | See 2 publications below |
Product Information
15349-1-AP targets CRIP1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7588 Product name: Recombinant human CRIP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC002738 Sequence: MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK Predict reactive species |
| Full Name | cysteine-rich protein 1 (intestinal) |
| Calculated Molecular Weight | 9 kDa |
| Observed Molecular Weight | 8-9 kDa |
| GenBank Accession Number | BC002738 |
| Gene Symbol | CRIP1 |
| Gene ID (NCBI) | 1396 |
| RRID | AB_2878128 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P50238 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CRIP1 also known as CRIP, CRP1, belongs to the LIM/double zinc finger protein family. CRIP1 has a unique double zinc finger motif, which is mainly expressed in the intestine, and may be involved in intestinal zinc transport (PMID: 31312368, 1946385). CRIP1 is overexpressed in immune cells of the epithelium and may play an important role in gut immunity(PMID: 27836662).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CRIP1 antibody 15349-1-AP | Download protocol |
| IHC protocol for CRIP1 antibody 15349-1-AP | Download protocol |
| WB protocol for CRIP1 antibody 15349-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
EBioMedicine CRIP1 involves the pathogenesis of multiple myeloma via dual-regulation of proteasome and autophagy
| ||
Dis Markers Cysteine-Rich Intestinal Protein 1 Served as an Epithelial Ovarian Cancer Marker via Promoting Wnt/β-Catenin-Mediated EMT and Tumour Metastasis.
| ||
EMBO J CRIP1 suppresses BBOX1-mediated carnitine metabolism to promote stemness in hepatocellular carcinoma | ||
Life (Basel) HIV Protein TAT Dysregulates Multiple Pathways in Human iPSCs-Derived Microglia | ||
Leuk Res CRIP1 supports the growth and migration of AML-M5 subtype cells by activating Wnt/β-catenin pathway
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Joleen (Verified Customer) (06-03-2019) | I labeled the 50 kD mark. CRIP1 should be a small protein ~8-9 kD. The blot was exposed for 120s and there were no bands with low molecular weight.
![]() |








