CRK Monoclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 67035-1-Ig (same clone as 67035-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67035-1-Ig (CRK antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67035-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67035-1-Ig (same clone as 67035-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67035-1-Ig (CRK antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67035-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 67035-1-Ig (same clone as 67035-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67035-1-Ig (CRK antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67035-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67035-1-Ig (same clone as 67035-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67035-1-Ig (CRK antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67035-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 67035-1-Ig (same clone as 67035-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 67035-1-Ig (CRK antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67035-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67035-1-Ig (same clone as 67035-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67035-1-Ig (CRK antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67035-1-PBS in a different storage buffer formulation.

CRK Monoclonal Antibody for WB, ELISA

Cat No. 67035-1-PBS

Clone No.2B7E1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

2B7E1, Adapter molecule crk, CRKII, p38, Proto oncogene c Crk

---

Product Information

67035-1-PBS targets CRK in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28793

  Product name: Recombinant human CRK protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 41-304 aa of BC008506

  Sequence: STSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS

• Full Name: v-crk sarcoma virus CT10 oncogene homolog (avian)
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC008506
• Gene Symbol: CRK
• Gene ID (NCBI): 1398
• RRID: AB_2882350
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P46108
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CRK is a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. CRK has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation.