Mouse CRLF2 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Mouse CRLF2 Recombinant monoclonal antibody, PBS Only (87914-4-PBS)

• 

  WB analysis of A20 using 87914-4-RR (same clone as 87914-4-PBS)

  A20 cells were subjected to SDS PAGE followed by western blot with 87914-4-RR (TSLPR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87914-4-PBS in a different storage buffer formulation.

• 

  WB analysis using 87914-4-RR (same clone as 87914-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87914-4-RR (TSLPR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87914-4-PBS in a different storage buffer formulation.

CRLF2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87914-4-PBS

Clone No.252992G8

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Indirect ELISA

Synonyms

Crlm2, CRLM-2, Cytokine receptor-like factor 2, Cytokine receptor-like molecule 2, Thymic stromal lymphopoietin protein receptor

---

Product Information

87914-4-PBS targets CRLF2 in WB, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg7520

  Product name: Recombinant mouse TSLPR protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 20-232 aa of /

  Sequence: AAAVTSRGDVTVVCHDLETVEVTWGSGPDHHGANLSLEFRYGTGALQPCPRYFLSGAGVTSGCILPAARAGLLELALRDGGGAMVFKARQRASAWLKPRPPWNVTLLWTPDGDVTVSWPAHSYLGLDYEVQHRESNDDEDAWQTTSGPCCDLTVGGLDPARCYDFRVRASPRAAHYGLEAQPSEWTAVTRLSGAASAASCTASPAPSPALAPP

• Full Name: cytokine receptor-like factor 2
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 38-45 kDa
• GenBank Accession Number: /
• Gene Symbol: Crlf2
• Gene ID (NCBI): 57914
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8CII9-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cytokine receptor-like factor 2 (CRLF2), also known as the thymic stromal derived lymphopoietin receptor (TSLPR), which in combination with the interleukin 7 receptor a chain (IL-7R) forms the receptor for thymic stromal lymphopoietin. CRLF2 is a type I cytokine receptor. CRLF2 rearrangements occur either as a translocation to the immunoglobulin heavy-chain enhancer region (IGH-CRLF2) or by a deletion of upstream PAR1 that leads to joining of CRLF2 to adjacent P2RY8. CRLF2 is expressed in heart, skeletal muscle, kidney and liver and is primarily expressed in dendrites and monocytes. The protein has phosphorylation modification and glycosylation modification.