CRLF2 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CRLF2 Recombinant monoclonal antibody (87914-4-RR)

• 

  WB analysis of A20 using 87914-4-RR

  A20 cells were subjected to SDS PAGE followed by western blot with 87914-4-RR (TSLPR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87914-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87914-4-RR (TSLPR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

CRLF2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87914-4-RR

Clone No.252992G8

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

Crlm2, CRLM-2, Cytokine receptor-like factor 2, Cytokine receptor-like molecule 2, Thymic stromal lymphopoietin protein receptor

---

Tested Applications

• Positive WB detected in: A20 cells, mouse lung tissue, mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87914-4-RR targets CRLF2 in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg7520

  Product name: Recombinant mouse TSLPR protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 20-232 aa of /

  Sequence: AAAVTSRGDVTVVCHDLETVEVTWGSGPDHHGANLSLEFRYGTGALQPCPRYFLSGAGVTSGCILPAARAGLLELALRDGGGAMVFKARQRASAWLKPRPPWNVTLLWTPDGDVTVSWPAHSYLGLDYEVQHRESNDDEDAWQTTSGPCCDLTVGGLDPARCYDFRVRASPRAAHYGLEAQPSEWTAVTRLSGAASAASCTASPAPSPALAPP

• Full Name: cytokine receptor-like factor 2
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 38-45 kDa
• GenBank Accession Number: /
• Gene Symbol: Crlf2
• Gene ID (NCBI): 57914
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8CII9-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytokine receptor-like factor 2 (CRLF2), also known as the thymic stromal derived lymphopoietin receptor (TSLPR), which in combination with the interleukin 7 receptor a chain (IL-7R) forms the receptor for thymic stromal lymphopoietin. CRLF2 is a type I cytokine receptor. CRLF2 rearrangements occur either as a translocation to the immunoglobulin heavy-chain enhancer region (IGH-CRLF2) or by a deletion of upstream PAR1 that leads to joining of CRLF2 to adjacent P2RY8. CRLF2 is expressed in heart, skeletal muscle, kidney and liver and is primarily expressed in dendrites and monocytes. The protein has phosphorylation modification and glycosylation modification.