CROP Polyclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 14504-1-AP (same clone as 14504-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14504-1-AP (CROP antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14504-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 14504-1-AP (same clone as 14504-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14504-1-AP (CROP antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14504-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 14504-1-AP (same clone as 14504-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14504-1-AP (CROP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14504-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 14504-1-AP (same clone as 14504-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14504-1-AP (CROP antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14504-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 14504-1-AP (same clone as 14504-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14504-1-AP (CROP antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14504-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 14504-1-AP (same clone as 14504-1-PBS)

  IP result of anti-CROP (IP:14504-1-AP, 4ug; Detection:14504-1-AP 1:500) with HepG2 cells lysate 3600ug. This data was developed using the same antibody clone with 14504-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 14504-1-AP (same clone as 14504-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 14504-1-AP (CROP antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14504-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 14504-1-AP (same clone as 14504-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tissue slide using 14504-1-AP (CROP Antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 14504-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 14504-1-AP (same clone as 14504-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tissue slide using 14504-1-AP (CROP Antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 14504-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 14504-1-AP (same clone as 14504-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 14504-1-AP (CROP Antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 14504-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 14504-1-AP (same clone as 14504-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 14504-1-AP (CROP Antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 14504-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 14504-1-AP (same clone as 14504-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CROP antibody (14504-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 14504-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CROP Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 14504-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

CREAP-1, CREAP1, CREAP 1, CRE associated protein 1, Cisplatin resistance-associated-overexpressed protein

---

Product Information

14504-1-PBS targets CROP in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5961

  Product name: Recombinant human CROP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-79 aa of BC056409

  Sequence: MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLDVFGRGDNISDVSKFLEDDKWMEE

• Full Name: cisplatin resistance-associated overexpressed protein
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 55-58 kDa
• GenBank Accession Number: BC056409
• Gene Symbol: CROP
• Gene ID (NCBI): 51747
• RRID: AB_2229967
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95232
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CROP, a putative SR protein, contain cystine/histidine motifs and leucine zipper-like repeats in the N-terminal half and consists mostly of charged and polar amino acids in the C-terminal half. CROP has a high expression in heart, brain, pancreas, thymus, and weak in lung, live and kidney. As the human homologue of yeast Luc7p, CROP is supported to be participated in 5'-splice site recognize and is essential for vegetative growth. This is a rabbit polyclonal antibody raised against part of N-terminus of CROP of human origin, and can recognize a ~58kDa band of CROP.