Product Information
66250-1-PBS targets C-Reactive Protein/CRP in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.
Tested Reactivity | human, mouse, rat, pig |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag9883 Product name: Recombinant human CRP protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-91 aa of BC020766 Sequence: MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWP Predict reactive species |
Full Name | C-reactive protein, pentraxin-related |
Calculated Molecular Weight | 224 aa, 25 kDa |
Observed Molecular Weight | 27 kDa |
GenBank Accession Number | BC020766 |
Gene Symbol | CRP |
Gene ID (NCBI) | 1401 |
RRID | AB_2881638 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P02741 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
C-reactive protein (CRP) is an acute-phase serum protein synthesized by the liver in response to interleukin-6 (IL-6) during inflammation. The name of CRP derives from its ability to react with the C polysaccharide of Streptococcus pneumoniae. CRP is an annular, pentameric protein that belongs to the pentraxin family of proteins. CRP displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It is used mainly as a marker of inflammation.