• Featured Product
  • KD/KO Validated

C-Reactive Protein/CRP Monoclonal antibody, PBS Only

C-Reactive Protein/CRP Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 66250-1-PBS
Clone No.3F10A11

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, Indirect ELISA

CRP, PTX1, C-reactive protein(1-205), C-Reactive Protein, C reactive protein

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66250-1-PBS targets C-Reactive Protein/CRP in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9883

Product name: Recombinant human CRP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-91 aa of BC020766

Sequence: MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWP

Predict reactive species
Full Name C-reactive protein, pentraxin-related
Calculated Molecular Weight 224 aa, 25 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC020766
Gene Symbol CRP
Gene ID (NCBI) 1401
RRIDAB_2881638
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02741
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

C-reactive protein (CRP) is an acute-phase serum protein synthesized by the liver in response to interleukin-6 (IL-6) during inflammation. The name of CRP derives from its ability to react with the C polysaccharide of Streptococcus pneumoniae. CRP is an annular, pentameric protein that belongs to the pentraxin family of proteins. CRP displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It is used mainly as a marker of inflammation.

Loading...
||
New chat Able
正在加载,请稍候...