C-Reactive Protein/CRP Monoclonal antibody, PBS Only

• 

  WB analysis of serum from mouse injected with bacteria using 66250-1-Ig (same clone as 66250-1-PBS)

  Serum from mouse injected with bacteria were subjected to SDS PAGE followed by western blot with 66250-1-Ig (C-Reactive Protein/CRP Antibody) at dilution of 1:2000. Horseradish peroxidase conjugated protein A was used for signal developing instead of secondary antibody incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66250-1-PBS in a different storage buffer formulation.

• 

  WB analysis of serum from mouse injected with bacteria using 66250-1-Ig (same clone as 66250-1-PBS)

  Serum from normal mouse (left) and mouse injected with bacteria (right) were subjected to SDS PAGE followed by western blot with 66250-1-Ig (C-Reactive Protein/CRP Antibody) at dilution of 1:1000. Horseradish peroxidase conjugated protein A was used for signal developing instead of secondary antibody incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66250-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig liver using 66250-1-Ig (same clone as 66250-1-PBS)

  pig liver tissue were subjected to SDS PAGE followed by western blot with 66250-1-Ig (C-Reactive Protein/CRP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66250-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 66250-1-Ig (same clone as 66250-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 66250-1-Ig (C-Reactive Protein/CRP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66250-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66250-1-Ig (same clone as 66250-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66250-1-Ig (C-Reactive Protein/CRP Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 66250-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66250-1-Ig (same clone as 66250-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66250-1-Ig (C-Reactive Protein/CRP Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 66250-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver using 66250-1-Ig (same clone as 66250-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver tissue using 66250-1-Ig (CRP antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66250-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

C-Reactive Protein/CRP Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 66250-1-PBS

Clone No.3F10A11

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

CRP, PTX1, C-reactive protein(1-205), C-Reactive Protein, C reactive protein

---

Product Information

66250-1-PBS targets C-Reactive Protein/CRP in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9883

  Product name: Recombinant human CRP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-91 aa of BC020766

  Sequence: MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWP

• Full Name: C-reactive protein, pentraxin-related
• Calculated Molecular Weight: 224 aa, 25 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC020766
• Gene Symbol: CRP
• Gene ID (NCBI): 1401
• RRID: AB_2881638
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02741
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C-reactive protein (CRP) is an acute-phase serum protein synthesized by the liver in response to interleukin-6 (IL-6) during inflammation. The name of CRP derives from its ability to react with the C polysaccharide of Streptococcus pneumoniae. CRP is an annular, pentameric protein that belongs to the pentraxin family of proteins. CRP displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It is used mainly as a marker of inflammation.