Tested Applications
Positive WB detected in | serum from mouse injected with bacteria, pig liver tissue, rat liver tissue, serum from mouse injected with bacteria tissue |
Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human liver tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 8 publications below |
IHC | See 3 publications below |
IF | See 2 publications below |
Product Information
66250-1-Ig targets C-Reactive Protein/CRP in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
Tested Reactivity | human, mouse, rat, pig |
Cited Reactivity | human, mouse, rat, monkey |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag9883 Product name: Recombinant human CRP protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-91 aa of BC020766 Sequence: MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWP Predict reactive species |
Full Name | C-reactive protein, pentraxin-related |
Calculated Molecular Weight | 224 aa, 25 kDa |
Observed Molecular Weight | 27 kDa |
GenBank Accession Number | BC020766 |
Gene Symbol | CRP |
Gene ID (NCBI) | 1401 |
RRID | AB_2881638 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P02741 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C-reactive protein (CRP) is an acute-phase serum protein synthesized by the liver in response to interleukin-6 (IL-6) during inflammation. The name of CRP derives from its ability to react with the C polysaccharide of Streptococcus pneumoniae. CRP is an annular, pentameric protein that belongs to the pentraxin family of proteins. CRP displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It is used mainly as a marker of inflammation.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for C-Reactive Protein/CRP antibody 66250-1-Ig | Download protocol |
IHC protocol for C-Reactive Protein/CRP antibody 66250-1-Ig | Download protocol |
IF protocol for C-Reactive Protein/CRP antibody 66250-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun Macrophage lineage cells-derived migrasomes activate complement-dependent blood-brain barrier damage in cerebral amyloid angiopathy mouse model | ||
Front Immunol Expression and clinical significance of interleukin-6 pathway in cholangiocarcinoma | ||
J Cell Mol Med Proteomic studies in VWA1-related neuromyopathy allowed new pathophysiological insights and the definition of blood biomarkers | ||
Front Immunol Binding of Macrophage Receptor MARCO, LDL, and LDLR to Disease-Associated Crystalline Structures. | ||
Sci Rep A label-free fiber optic SPR biosensor for specific detection of C-reactive protein. | ||
Sci Rep C-reactive protein (CRP) recognizes uric acid crystals and recruits proteases C1 and MASP1. |