• Featured Product
  • KD/KO Validated

C-Reactive Protein/CRP Monoclonal antibody

C-Reactive Protein/CRP Monoclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 66250-1-Ig
Clone No.3F10A11

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig and More (1)

Applications

WB, IHC, IF-P, ELISA

CRP, PTX1, C-reactive protein(1-205), C-Reactive Protein, C reactive protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inserum from mouse injected with bacteria, pig liver tissue, rat liver tissue, serum from mouse injected with bacteria tissue
Positive IHC detected inhuman liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66250-1-Ig targets C-Reactive Protein/CRP in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, monkey
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9883

Product name: Recombinant human CRP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-91 aa of BC020766

Sequence: MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWP

Predict reactive species
Full Name C-reactive protein, pentraxin-related
Calculated Molecular Weight 224 aa, 25 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC020766
Gene Symbol CRP
Gene ID (NCBI) 1401
RRIDAB_2881638
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02741
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C-reactive protein (CRP) is an acute-phase serum protein synthesized by the liver in response to interleukin-6 (IL-6) during inflammation. The name of CRP derives from its ability to react with the C polysaccharide of Streptococcus pneumoniae. CRP is an annular, pentameric protein that belongs to the pentraxin family of proteins. CRP displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It is used mainly as a marker of inflammation.

Protocols

Product Specific Protocols
IF protocol for C-Reactive Protein/CRP antibody 66250-1-IgDownload protocol
IHC protocol for C-Reactive Protein/CRP antibody 66250-1-IgDownload protocol
WB protocol for C-Reactive Protein/CRP antibody 66250-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB

Nat Commun

Macrophage lineage cells-derived migrasomes activate complement-dependent blood-brain barrier damage in cerebral amyloid angiopathy mouse model

Authors - Mengyan Hu
humanIF

Front Immunol

Expression and clinical significance of interleukin-6 pathway in cholangiocarcinoma

Authors - Dongqing Gu
humanIHC

J Cell Mol Med

Proteomic studies in VWA1-related neuromyopathy allowed new pathophysiological insights and the definition of blood biomarkers

Authors - Mohammed Athamneh
mouseWB

Front Immunol

Binding of Macrophage Receptor MARCO, LDL, and LDLR to Disease-Associated Crystalline Structures.

Authors - Anika Alberts

Sci Rep

A label-free fiber optic SPR biosensor for specific detection of C-reactive protein.

Authors - Wenjia Wang
humanWB

Sci Rep

C-reactive protein (CRP) recognizes uric acid crystals and recruits proteases C1 and MASP1.

Authors - Anika Alberts
Loading...
||
New chat Able
正在加载,请稍候...