Tested Applications
| Positive WB detected in | serum from mouse injected with bacteria, pig liver tissue, rat liver tissue, serum from mouse injected with bacteria tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human liver tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 9 publications below |
| IHC | See 4 publications below |
| IF | See 2 publications below |
Product Information
66250-1-Ig targets C-Reactive Protein/CRP in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig, monkey |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9883 Product name: Recombinant human CRP protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-91 aa of BC020766 Sequence: MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWP Predict reactive species |
| Full Name | C-reactive protein, pentraxin-related |
| Calculated Molecular Weight | 224 aa, 25 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC020766 |
| Gene Symbol | CRP |
| Gene ID (NCBI) | 1401 |
| RRID | AB_2881638 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P02741 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C-reactive protein (CRP) is an acute-phase serum protein synthesized by the liver in response to interleukin-6 (IL-6) during inflammation. The name of CRP derives from its ability to react with the C polysaccharide of Streptococcus pneumoniae. CRP is an annular, pentameric protein that belongs to the pentraxin family of proteins. CRP displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It is used mainly as a marker of inflammation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for C-Reactive Protein/CRP antibody 66250-1-Ig | Download protocol |
| IHC protocol for C-Reactive Protein/CRP antibody 66250-1-Ig | Download protocol |
| WB protocol for C-Reactive Protein/CRP antibody 66250-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Macrophage lineage cells-derived migrasomes activate complement-dependent blood-brain barrier damage in cerebral amyloid angiopathy mouse model | ||
Front Immunol Expression and clinical significance of interleukin-6 pathway in cholangiocarcinoma | ||
J Cell Mol Med Proteomic studies in VWA1-related neuromyopathy allowed new pathophysiological insights and the definition of blood biomarkers | ||
Front Immunol Binding of Macrophage Receptor MARCO, LDL, and LDLR to Disease-Associated Crystalline Structures. | ||
Sci Rep A label-free fiber optic SPR biosensor for specific detection of C-reactive protein. | ||
Sci Rep C-reactive protein (CRP) recognizes uric acid crystals and recruits proteases C1 and MASP1. |













