CRX Monoclonal antibody

• 

  WB analysis using 67555-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67555-1-Ig (CRX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Y79 using 67555-1-Ig

  Y79 cells were subjected to SDS PAGE followed by western blot with 67555-1-Ig (CRX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse eye using 67555-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 67555-1-Ig (CRX antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CRX Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67555-1-Ig

Clone No.1C3C11

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig

Applications

WB, IHC, ELISA

Synonyms

cone rod homeobox, Cone rod homeobox protein, CORD2, CRD, CRX, LCA7, OTX3

---

Tested Applications

• Positive WB detected in: rat retina tissue, Y79 cells, mouse retina tissue, pig retina tissue
• Positive IHC detected in: mouse eye tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:2000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67555-1-Ig targets CRX in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples.

• Tested Reactivity: Human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30086

  Product name: Recombinant human CRX protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 166-285 aa of BC016664

  Sequence: ASESPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFKDPTGTWKFTYNPMDP

• Full Name: cone-rod homeobox
• Calculated Molecular Weight: 299 aa, 32 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC016664
• Gene Symbol: CRX
• Gene ID (NCBI): 1406
• RRID: AB_2882769
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43186
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cone-rod homeobox (Crx) is a homeodomain transcription factor and member of the Otx family, which has been thought to play a critical role in determining and maintaining the phenotype of both pinealocytes and retinal photoreceptors [PMID:17467693]. In the mammalian retina, Crx plays an essential role in the normal development and maintenance of cones and rods and regulates expression of the network of genes that characterize the retina [PMID:17653270]. Elimination of Crx by disruption of the homeobox domain results in loss of the image-forming visual system but not the non-image-forming visual system controlling circadian rhythms [PMID:20438719].

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Alessandro (Verified Customer) (02-04-2025)

high specificity and sensitivity, providing reliable and reproducible results

• Applications: Immunohistochemistry, Immunofluorescence
• Primary Antibody Dilution: 1:200