CRX Monoclonal antibody

CRX Monoclonal Antibody for WB, IHC, ELISA
Cat No. 67555-1-Ig
Clone No.1C3C11

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig

Applications

WB, IHC, ELISA

cone rod homeobox, Cone rod homeobox protein, CORD2, CRD, CRX, LCA7, OTX3

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat retina tissue, Y79 cells, mouse retina tissue, pig retina tissue
Positive IHC detected inmouse eye tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67555-1-Ig targets CRX in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples.

Tested Reactivity Human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30086

Product name: Recombinant human CRX protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 166-285 aa of BC016664

Sequence: ASESPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFKDPTGTWKFTYNPMDP

Predict reactive species
Full Name cone-rod homeobox
Calculated Molecular Weight 299 aa, 32 kDa
Observed Molecular Weight 37 kDa
GenBank Accession NumberBC016664
Gene Symbol CRX
Gene ID (NCBI) 1406
RRIDAB_2882769
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO43186
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cone-rod homeobox (Crx) is a homeodomain transcription factor and member of the Otx family, which has been thought to play a critical role in determining and maintaining the phenotype of both pinealocytes and retinal photoreceptors [PMID:17467693]. In the mammalian retina, Crx plays an essential role in the normal development and maintenance of cones and rods and regulates expression of the network of genes that characterize the retina [PMID:17653270]. Elimination of Crx by disruption of the homeobox domain results in loss of the image-forming visual system but not the non-image-forming visual system controlling circadian rhythms [PMID:20438719].

Protocols

Product Specific Protocols
WB protocol for CRX antibody 67555-1-IgDownload protocol
IHC protocol for CRX antibody 67555-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Alessandro (Verified Customer) (02-04-2025)

high specificity and sensitivity, providing reliable and reproducible results

  • Applications: Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:200
Loading...
||
New chat Able
正在加载,请稍候...