Use Able AI chat for product recommendations

CRX Monoclonal antibody

CRX Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67555-1-Ig
Clone No.1C3C11

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig

Applications

WB, IHC, ELISA

cone rod homeobox, Cone rod homeobox protein, CORD2, CRD, CRX, LCA7, OTX3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat retina tissue, Y79 cells, mouse retina tissue, pig retina tissue
Positive IHC detected inmouse eye tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67555-1-Ig targets CRX in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples.

Tested Reactivity Human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30086

Product name: Recombinant human CRX protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 166-285 aa of BC016664

Sequence: ASESPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFKDPTGTWKFTYNPMDP

Predict reactive species
Full Name cone-rod homeobox
Calculated Molecular Weight 299 aa, 32 kDa
Observed Molecular Weight 37 kDa
GenBank Accession NumberBC016664
Gene Symbol CRX
Gene ID (NCBI) 1406
RRIDAB_2882769
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO43186
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cone-rod homeobox (Crx) is a homeodomain transcription factor and member of the Otx family, which has been thought to play a critical role in determining and maintaining the phenotype of both pinealocytes and retinal photoreceptors [PMID:17467693]. In the mammalian retina, Crx plays an essential role in the normal development and maintenance of cones and rods and regulates expression of the network of genes that characterize the retina [PMID:17653270]. Elimination of Crx by disruption of the homeobox domain results in loss of the image-forming visual system but not the non-image-forming visual system controlling circadian rhythms [PMID:20438719].

Protocols

Product Specific Protocols
IHC protocol for CRX antibody 67555-1-IgDownload protocol
WB protocol for CRX antibody 67555-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Alessandro (Verified Customer) (02-04-2025)

high specificity and sensitivity, providing reliable and reproducible results

  • Applications: Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:200
Loading...
||
New chat

Able

正在加载,请稍候...