Product Information
67555-1-PBS targets CRX as part of a matched antibody pair:
MP51402-2: 67555-1-PBS capture and 67555-4-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30086 Product name: Recombinant human CRX protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 166-285 aa of BC016664 Sequence: ASESPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFKDPTGTWKFTYNPMDP Predict reactive species |
| Full Name | cone-rod homeobox |
| Calculated Molecular Weight | 299 aa, 32 kDa |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC016664 |
| Gene Symbol | CRX |
| Gene ID (NCBI) | 1406 |
| RRID | AB_2882769 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O43186 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Cone-rod homeobox (Crx) is a homeodomain transcription factor and member of the Otx family, which has been thought to play a critical role in determining and maintaining the phenotype of both pinealocytes and retinal photoreceptors [PMID:17467693]. In the mammalian retina, Crx plays an essential role in the normal development and maintenance of cones and rods and regulates expression of the network of genes that characterize the retina [PMID:17653270]. Elimination of Crx by disruption of the homeobox domain results in loss of the image-forming visual system but not the non-image-forming visual system controlling circadian rhythms [PMID:20438719].









