CRX Monoclonal antibody, PBS Only (Capture)

CRX Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA, Sample test
Cat No. 67555-1-PBS
Clone No.1C3C11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, Cytometric bead array, Indirect ELISA, Sample test

1C3C11, cone rod homeobox, Cone-rod homeobox protein, CORD2, CRD

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67555-1-PBS targets CRX as part of a matched antibody pair:

MP51402-2: 67555-1-PBS capture and 67555-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30086

Product name: Recombinant human CRX protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 166-285 aa of BC016664

Sequence: ASESPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFKDPTGTWKFTYNPMDP

Predict reactive species
Full Name cone-rod homeobox
Calculated Molecular Weight 299 aa, 32 kDa
Observed Molecular Weight 37 kDa
GenBank Accession NumberBC016664
Gene Symbol CRX
Gene ID (NCBI) 1406
RRIDAB_2882769
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO43186
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Cone-rod homeobox (Crx) is a homeodomain transcription factor and member of the Otx family, which has been thought to play a critical role in determining and maintaining the phenotype of both pinealocytes and retinal photoreceptors [PMID:17467693]. In the mammalian retina, Crx plays an essential role in the normal development and maintenance of cones and rods and regulates expression of the network of genes that characterize the retina [PMID:17653270]. Elimination of Crx by disruption of the homeobox domain results in loss of the image-forming visual system but not the non-image-forming visual system controlling circadian rhythms [PMID:20438719].

Loading...
||
New chat Able
正在加载,请稍候...