• Featured Product
  • KD/KO Validated

Cystatin SN/CST1 Polyclonal antibody

Cystatin SN/CST1 Polyclonal Antibody for WB, FC (Intra), ELISA
Cat No. 16025-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, FC (Intra), IP, CoIP, ChIP, ELISA

CST1, Cystain SA I, Cystain-SA-I, Cystatin 1, cystatin SN

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMDA-MB-231 cells, COLO 320 cells, human adrenal gland tissue, human testis tissue, human saliva, SW480 cells, mouse skin tissue
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16025-1-AP targets Cystatin SN/CST1 in WB, IHC, IF, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8862

Product name: Recombinant human CST1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-141 aa of BC021225

Sequence: KEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES

Predict reactive species
Full Name cystatin SN
Calculated Molecular Weight 141 aa, 16 kDa
Observed Molecular Weight 14-16 kDa
GenBank Accession NumberBC021225
Gene Symbol CST1
Gene ID (NCBI) 1469
RRIDAB_10916385
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01037
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CST1, or cystatin SN, is a gene in humans that encodes a secreted protein belonging to the type 2 cystatin superfamily, which includes CST1, CST2, CST3, CST4, and CST5. These proteins are cysteine proteinase inhibitors found in various human fluids and secretions, where they appear to provide protective functions. CST1 is specifically found in saliva, tears, urine, and seminal fluid, and it plays a role in inhibiting the activity of cysteine proteases. CST1 has been implicated in various pathological processes, including tumor invasion and metastasis. Overexpression of CST1 has been observed in several types of cancer, such as lung, breast, colorectal, and gastric cancer, suggesting its role in the proliferation, invasion, and metastasis of these tumors.

Protocols

Product Specific Protocols
FC protocol for Cystatin SN/CST1 antibody 16025-1-APDownload protocol
WB protocol for Cystatin SN/CST1 antibody 16025-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Cell Rep Med

Personalized drug screening in patient-derived organoids of biliary tract cancer and its clinical application

Authors - Xiaoxue Ren
humanIHC,IF

Nat Commun

Integrated single-cell transcriptome analysis reveals heterogeneity of esophageal squamous cell carcinoma microenvironment.

Authors - Huy Q Dinh
humanWB

Cell Res

Differential secretome analysis reveals CST6 as a suppressor of breast cancer bone metastasis.

Authors - Jin Lei L
humanWB,IP,IHC,IF

Oncogene

CST1 inhibits ferroptosis and promotes gastric cancer metastasis by regulating GPX4 protein stability via OTUB1

Authors - Dongbao Li
  • KD Validated
humanWB

Mol Oncol

Cancer-associated fibroblasts educate normal fibroblasts to facilitate cancer cell spreading and T cell suppression.

Authors - Go Itoh
humanIHC

Aging (Albany NY)

Transcriptional dysregulation of TRIM29 promotes colorectal cancer carcinogenesis via pyruvate kinase-mediated glucose metabolism.

Authors - Jing Han
Loading...
||
New chat

Able

正在加载,请稍候...