Cystatin SN/CST1 Polyclonal antibody, PBS Only

• 

  WB analysis of human saliva using 16025-1-AP (same clone as 16025-1-PBS)

  human saliva were subjected to SDS PAGE followed by western blot with 16025-1-AP (CST1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16025-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 16025-1-AP (same clone as 16025-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16025-1-AP (CST1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16025-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 16025-1-AP (same clone as 16025-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 16025-1-AP (CST1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16025-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human adrenal gland using 16025-1-AP (same clone as 16025-1-PBS)

  human adrenal gland tissue were subjected to SDS PAGE followed by western blot with 16025-1-AP (CST1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16025-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 16025-1-AP (same clone as 16025-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 16025-1-AP (CST1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16025-1-PBS in a different storage buffer formulation.

• 

  FC experiment of MCF-7 using 16025-1-AP (same clone as 16025-1-PBS)

  1X10^6 MCF-7 cells were intracellularly stained with 0.4 ug Anti-Human CST1 (16025-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 16025-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Cystatin SN/CST1 Polyclonal Antibody for WB, FC (Intra), ELISA

Cat No. 16025-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), ELISA

Synonyms

CST1, Cystain SA I, Cystain-SA-I, Cystatin 1, cystatin SN

---

Product Information

16025-1-PBS targets Cystatin SN/CST1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8862

  Product name: Recombinant human CST1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-141 aa of BC021225

  Sequence: KEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES

• Full Name: cystatin SN
• Calculated Molecular Weight: 141 aa, 16 kDa
• Observed Molecular Weight: 14-16 kDa
• GenBank Accession Number: BC021225
• Gene Symbol: CST1
• Gene ID (NCBI): 1469
• RRID: AB_10916385
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01037
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CST1, or cystatin SN, is a gene in humans that encodes a secreted protein belonging to the type 2 cystatin superfamily, which includes CST1, CST2, CST3, CST4, and CST5. These proteins are cysteine proteinase inhibitors found in various human fluids and secretions, where they appear to provide protective functions. CST1 is specifically found in saliva, tears, urine, and seminal fluid, and it plays a role in inhibiting the activity of cysteine proteases. CST1 has been implicated in various pathological processes, including tumor invasion and metastasis. Overexpression of CST1 has been observed in several types of cancer, such as lung, breast, colorectal, and gastric cancer, suggesting its role in the proliferation, invasion, and metastasis of these tumors.