• Featured Product
  • KD/KO Validated

Cystatin C Polyclonal antibody

Cystatin C Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 12245-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

CST3, Cystatin 3, Cystatin-3, Cystatin-C, Gamma-trace

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCaco-2 cells, fetal human brain tissue, HepG2 cells, human milk, HeLa cells, U-87 MG cells, U2OS cells, human urine, human serum, mouse brain tissue
Positive IP detected inCaco-2 cells
Positive IHC detected inmouse kidney tissue, human kidney tissue, human ovary tissue, human ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse kidney tissue
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:2000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12245-1-AP targets Cystatin C in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig, duck
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2890

Product name: Recombinant human Cystatin C protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-146 aa of BC013083

Sequence: AGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Predict reactive species
Full Name cystatin C
Calculated Molecular Weight 146 aa, 16 kDa
Observed Molecular Weight 13 kDa
GenBank Accession NumberBC013083
Gene Symbol Cystatin C
Gene ID (NCBI) 1471
RRIDAB_2088058
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01034
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cystatin C is a 13-kDa inhibitor of cysteine proteinases which is secreted by all cell types and is completely cleared from the organism through glomerular filtration, shown to be an early and sensitive biomarker of renal dysfunction. It is also used as an emerging biomarker in cardiovascular disease. Cystatin C is involved in a variety of inflammatory reactions. The concentration of serum cystatin C has also been shown to be unaltered in certain inflammatory conditions or other disorders of metabolism. The plasma level of serum cystatin C can be expressed as its level of generation from cells and diet and its subsequent elimination through the gut, liver, and kidneys.

Protocols

Product Specific Protocols
IF protocol for Cystatin C antibody 12245-1-APDownload protocol
IHC protocol for Cystatin C antibody 12245-1-APDownload protocol
IP protocol for Cystatin C antibody 12245-1-APDownload protocol
WB protocol for Cystatin C antibody 12245-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
pigWB

Biosens Bioelectron

Microneedle patches integrated with lateral flow cassettes for blood-free chronic kidney disease point-of-care testing during a pandemic.

Authors - Yi-Jyun Chen
humanWB,IF

Environ Pollut

Insight into the negative impact of ionic liquid: A cytotoxicity mechanism of 1-methyl-3-octylimidazolium bromide.

Authors - Junguo Ma
humanWB

J Hazard Mater

Graphene oxide disrupted mitochondrial homeostasis through inducing intracellular redox deviation and autophagy-lysosomal network dysfunction in SH-SY5Y cells.

Authors - Feng Xiaoli
ratWB

Cell Biol Toxicol

Inhibition of ER stress attenuates kidney injury and apoptosis induced by 3-MCPD via regulating mitochondrial fission/fusion and Ca2+ homeostasis.

Authors - Yujie Zhong
rat,humanWB

Mol Nutr Food Res

Diosgenin Protects Against Kidney Injury and Mitochondrial Apoptosis Induced by 3-MCPD Through the Regulation of ER Stress, Ca2+ Homeostasis, and Bcl2 Expression.

Authors - Yujie Zhong
ratWB

J Cell Mol Med

LINC00963 targeting miR-128-3p promotes acute kidney injury process by activating JAK2/STAT1 pathway.

Authors - Li-Bo Xie
Loading...
||
New chat

Able

正在加载,请稍候...