Tested Applications
| Positive IF-P detected in | mouse kidney tissue |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-12245 targets Cystatin C in IF/ICC, IF-P applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2890 Product name: Recombinant human Cystatin C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-146 aa of BC013083 Sequence: AGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA Predict reactive species |
| Full Name | cystatin C |
| Calculated Molecular Weight | 146 aa, 16 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | BC013083 |
| Gene Symbol | Cystatin C |
| Gene ID (NCBI) | 1471 |
| RRID | AB_3083922 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01034 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Cystatin C is a 13-kDa inhibitor of cysteine proteinases which is secreted by all cell types and is completely cleared from the organism through glomerular filtration, shown to be an early and sensitive biomarker of renal dysfunction. It is also used as an emerging biomarker in cardiovascular disease. Cystatin C is involved in a variety of inflammatory reactions. The concentration of serum cystatin C has also been shown to be unaltered in certain inflammatory conditions or other disorders of metabolism. The plasma level of serum cystatin C can be expressed as its level of generation from cells and diet and its subsequent elimination through the gut, liver, and kidneys.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 Cystatin C antibody CL488-12245 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





