• Featured Product
  • KD/KO Validated

p120 Catenin Monoclonal antibody

p120 Catenin Monoclonal Antibody for WB, IHC, IF/ICC, IF-Fro, ELISA
Cat No. 66208-1-Ig
Clone No.2F7H8

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-Fro, IP, ELISA

CTNND1, Cadherin-associated Src substrate, CAS, Catenin delta 1, Catenin delta-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected infetal human brain tissue, HeLa cells, HEK-293 cells, A549 cells, mouse brain tissue, A431 cells, HSC-T6 cells, NIH/3T3 cells
Positive IHC detected inhuman breast cancer tissue, human colon cancer tissue, mouse colon tissue, rat colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-Fro detected inmouse breast cancer
Positive IF/ICC detected inA431 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)-FROIF-FRO : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:400
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66208-1-Ig targets p120 Catenin in WB, IHC, IF/ICC, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2824

Product name: Recombinant human CTNND1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 546-830 aa of BC010501

Sequence: GYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNKTLDRSGDLGDMEPLKGTTPLMQKI

Predict reactive species
Full Name catenin (cadherin-associated protein), delta 1
Calculated Molecular Weight 948 aa, 105 kDa
Observed Molecular Weight 90-120 kDa
GenBank Accession NumberBC010501
Gene Symbol p120 Catenin
Gene ID (NCBI) 1500
RRIDAB_2881599
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO60716
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Catenins were discovered as proteins that are linked to the cytoplasmic domain of transmembrane cadherins (PMID: 9653641). p120 catenin, also called p120 ctn or catenin delta-1, regulates cell-cell adhesion through its interaction with the cytoplasmic tail of classical and type II cadherins. p120 catenin is a tyrosine kinase substrate implicated in cell transformation by SRC, as well as in ligand-induced receptor signaling through the EGF receptor, the PDGF receptor, and the CSF1 receptor. Different expression patterns of p120 catenin in lobular and ductal carcinomas of breast have been reported: membrane stain for ductal carcinoma and cytoplasmic stain for lobular carcinoma (PMID: 24966968). Different isoforms of p120 catenin are variably expressed in different tissues as a result of alternative splicing and the use of multiple translation initiation codons (PMID: 19150613).

Protocols

Product Specific Protocols
IF protocol for p120 Catenin antibody 66208-1-IgDownload protocol
IHC protocol for p120 Catenin antibody 66208-1-IgDownload protocol
WB protocol for p120 Catenin antibody 66208-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF,IP

Mol Oncol

Kaiso phosphorylation at threonine 606 leads to its accumulation in the cytoplasm, reducing its transcriptional repression of the tumour suppressor CDH1.

Authors - Wei Tian
mouseIF

Development

Ontogenesis of the tear drainage system requires Prickle1-driven polarized basement membrane deposition.

Authors - Dianlei Guo
humanIP

Proc Natl Acad Sci U S A

SENCR stabilizes vascular endothelial cell adherens junctions through interaction with CKAP4.

Authors - Qing Lyu
ratIF,WB

Biomed Pharmacother

Inhibition of autophagy and RIP1/RIP3/MLKL-mediated necroptosis by edaravone attenuates blood spinal cord barrier disruption following spinal cord injury

Authors - Bo Xu

Cancer Discov

Spatial Transcriptomics of Intraductal Papillary Mucinous Neoplasms of the Pancreas Identifies NKX6-2 as a Driver of Gastric Differentiation and Indolent Biological Potential

Authors - Marta Sans
humanWB

Clin Exp Pharmacol Physiol

Colorectal cancer cells with stably expressed SIRT3 demonstrate proliferating retardation by Wnt/β-catenin cascade inactivation

Authors - Tianyu Li
Loading...
||
New chat Able
正在加载,请稍候...