• Featured Product
  • KD/KO Validated

p120 Catenin Monoclonal antibody, PBS Only

p120 Catenin Monoclonal Antibody for WB, IHC, IF/ICC, IF-Fro, Indirect ELISA
Cat No. 66208-1-PBS
Clone No.2F7H8

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-Fro, Indirect ELISA

CTNND1, Cadherin-associated Src substrate, CAS, Catenin delta 1, Catenin delta-1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66208-1-PBS targets p120 Catenin in WB, IHC, IF/ICC, IF-Fro, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2824

Product name: Recombinant human CTNND1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 546-830 aa of BC010501

Sequence: GYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNKTLDRSGDLGDMEPLKGTTPLMQKI

Predict reactive species
Full Name catenin (cadherin-associated protein), delta 1
Calculated Molecular Weight 948 aa, 105 kDa
Observed Molecular Weight 90-120 kDa
GenBank Accession NumberBC010501
Gene Symbol p120 Catenin
Gene ID (NCBI) 1500
RRIDAB_2881599
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO60716
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Catenins were discovered as proteins that are linked to the cytoplasmic domain of transmembrane cadherins (PMID: 9653641). p120 catenin, also called p120 ctn or catenin delta-1, regulates cell-cell adhesion through its interaction with the cytoplasmic tail of classical and type II cadherins. p120 catenin is a tyrosine kinase substrate implicated in cell transformation by SRC, as well as in ligand-induced receptor signaling through the EGF receptor, the PDGF receptor, and the CSF1 receptor. Different expression patterns of p120 catenin in lobular and ductal carcinomas of breast have been reported: membrane stain for ductal carcinoma and cytoplasmic stain for lobular carcinoma (PMID: 24966968). Different isoforms of p120 catenin are variably expressed in different tissues as a result of alternative splicing and the use of multiple translation initiation codons (PMID: 19150613).

Loading...
||
New chat Able
正在加载,请稍候...