• Featured Product
  • KD/KO Validated

Cathepsin K Polyclonal antibody

Cathepsin K Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 11239-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

CTSK, Cathepsin X, catK, CTSO, CTSO2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, U-87 MG cells, ROS1728 cells
Positive IP detected inROS1728 cells
Positive IHC detected inhuman breast cancer tissue, human lung cancer tissue, human osteosarcoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive IF/ICC detected inROS1728 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11239-1-AP targets Cathepsin K in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1761

Product name: Recombinant human CTSK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-329 aa of BC016058

Sequence: MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

Predict reactive species
Full Name cathepsin K
Calculated Molecular Weight 39 kDa
Observed Molecular Weight27 kDa, 38~46 kDa
GenBank Accession NumberBC016058
Gene Symbol Cathepsin K
Gene ID (NCBI) 1513
RRIDAB_2245581
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP43235
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CTSK(cathepsin K), also named CTSO, CTSO2, is a recently identified lysosomal cysteine proteinase. CTSK is synthesized as a proenzyme of 38 kDa and subsequently enters acidic lysosomal compartments, in which the propeptide is cleaved and transformed into an active enzyme and it may influence adipocyte differentiation through modifying extracellular matrix components(PMID:16912123). It is revealed both the 46-kDa cathepsin-K precursor and the 30-kDa mature form in mouse bone extracts (PMID:9811821). The high CTSK protein levels are only detected in primary cultured fibroblasts derived from normal and neoplastic breast tissue, where the 37- and 25-kDa bands to be detected correspond to pro- and mature proteins through western blot (PMID:18765527). The full length protein has a signal peptides with 15 amino acids and a propeptide with 99 amino acids. CTSK may have cross reaction with the other members of cathepsin family and form a complex of 70 kDa with an unidentified subunit(PMID:1930136).

Protocols

Product Specific Protocols
IF protocol for Cathepsin K antibody 11239-1-APDownload protocol
IHC protocol for Cathepsin K antibody 11239-1-APDownload protocol
IP protocol for Cathepsin K antibody 11239-1-APDownload protocol
WB protocol for Cathepsin K antibody 11239-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nat Cell Biol

Circadian control of the secretory pathway maintains collagen homeostasis.

Authors - Joan Chang
mouseIHC,IF

Biomaterials

BMP2 immune complexes promote new bone formation by facilitating the direct contact between osteoclasts and osteoblasts.

Authors - Yamei Xu
mouseWB,IF

Dev Cell

Gasdermin D maintains bone mass by rewiring the endo-lysosomal pathway of osteoclastic bone resorption

Authors - Mobai Li
mouseWB

ACS Appl Mater Interfaces

Nel-like Molecule Type 1 Combined with Gold Nanoparticles Modulates Macrophage Polarization, Osteoclastogenesis, and Oral Microbiota in Periodontitis

Authors - Wenzheng Liao
mouseWB

Br J Pharmacol

Andrographolide prevents bone loss via targeting ERRalpha-regulated metabolic adaption of osteoclastogenesis.

Authors - Tongling Huang
mouseIHC

Arthritis Rheum

Co-opting endogenous immunoglobulin for the regulation of inflammation and osteoclastogenesis in humans and mice.

Authors - MacLellan Lindsay M LM

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Isabel (Verified Customer) (07-03-2020)

Antibody worked really well to detect Cathepsin K in protein from mouse osteoclasts. Blot was really clean with no other bands.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Primary mouse osteoclasts
Cathepsin K Antibody Western Blot validation (1:500 dilution) in Primary mouse osteoclasts (Cat no:11239-1-AP)
FH

RICHA (Verified Customer) (10-09-2019)

Good but hard to get the signal

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Protein from mouse tail tendon
Cathepsin K Antibody Western Blot, validation (1:500 dilution) in Protein from mouse tail tendon (Cat no:11239-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...