• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Cathepsin K Polyclonal antibody

Cathepsin K Polyclonal Antibody for IF-P, FC (Intra)
Cat No. CL488-11239

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P, FC (Intra)

CTSK, EC:3.4.22.38, CTSO2, CTSO, catK

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue
Positive FC (Intra) detected inU2OS cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11239 targets Cathepsin K in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1761

Product name: Recombinant human CTSK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-329 aa of BC016058

Sequence: MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

Predict reactive species
Full Name cathepsin K
Calculated Molecular Weight 39 kDa
Observed Molecular Weight 29-36 kDa
GenBank Accession NumberBC016058
Gene Symbol Cathepsin K
Gene ID (NCBI) 1513
RRIDAB_3672489
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP43235
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CTSK(cathepsin K), also named as CTSO, CTSO2, is a recently identified lysosomal cysteine proteinase. CTSK is synthesized as a proenzyme of 38 kDa and subsequently enters acidic lysosomal compartments, in which the propeptide is cleaved and transformed into an active enzyme and it may influence adipocyte differentiation through modifying extracellular matrix components(PMID:16912123). It is revealed both the 46-kDa cathepsin-K precursor and the 30-kDa mature form in mouse bone extracts(PMID:9811821). The high CTSK protein levels are only detected in primary cultured fibroblasts derived from normal and neoplastic breast tissue, where the 37- and 25-kDa bands to be detected correspond to pro- and mature proteins through western blot(PMID:18765527). The full length protein has a signal peptides with 15 amino acids and a propeptide with 99 amino acids. CTSK may have cross reaction with the other members of cathepsin family and form a complex of 70 kDa with an unidentified subunit(PMID:1930136).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Cathepsin K antibody CL488-11239Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...