CX3CR1 Polyclonal antibody, PBS Only

CX3CR1 Polyclonal Antibody for WB, IF-P, Indirect ELISA
Cat No. 29819-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, Indirect ELISA

Beta chemokine receptor like 1, Beta chemokine receptor-like 1, C X3 C CKR 1, CCRL1, CMK BRL 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

29819-1-PBS targets CX3CR1 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27698

Product name: Recombinant human CX3CR1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 56-231 aa of BC028078

Sequence: LTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIK

Predict reactive species
Full Name chemokine (C-X3-C motif) receptor 1
Calculated Molecular Weight 40 kDa
Observed Molecular Weight40 kDa, 44 kDa
GenBank Accession NumberBC028078
Gene Symbol CX3CR1
Gene ID (NCBI) 1524
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP49238
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CX3CR1, also known as GPR13, V28 and fractalkine receptor, belongs to the 7-transmembrane G protein-coupled receptor (GPCR) family. It is expressed on microglia, astrocytes, NK cells, monocytes/macrophages, and a subpopulation of T cells. CX3CR1 is the receptor for fractalkine (CX3CL1) and mediates both its adhesive and migratory functions. It also acts as coreceptor with CD4 for HIV-1 virus envelope protein (in vitro), and some variations in the gene of CX3CR1 lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Defects in CX3CR1 are a cause of susceptibility to age-related macular degeneration type 12 (ARMD12). The two CX3CR1 bands exhibited can be attributed to various factors (PMID: 30628679).

Loading...
||
New chat Able
正在加载,请稍候...