CX3CR1 Polyclonal antibody, PBS Only

• 

  WB analysis using 29819-1-AP (same clone as 29819-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29819-1-AP (CX3CR1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29819-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse kidney using 29819-1-AP (same clone as 29819-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse kidney tissue using CX3CR1 antibody (29819-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 29819-1-PBS in a different storage buffer formulation.

CX3CR1 Polyclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 29819-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, Indirect ELISA

Synonyms

Beta chemokine receptor like 1, Beta chemokine receptor-like 1, C X3 C CKR 1, CCRL1, CMK BRL 1

---

Product Information

29819-1-PBS targets CX3CR1 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27698

  Product name: Recombinant human CX3CR1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 56-231 aa of BC028078

  Sequence: LTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIK

• Full Name: chemokine (C-X3-C motif) receptor 1
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 40 kDa, 44 kDa
• GenBank Accession Number: BC028078
• Gene Symbol: CX3CR1
• Gene ID (NCBI): 1524
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49238
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CX3CR1, also known as GPR13, V28 and fractalkine receptor, belongs to the 7-transmembrane G protein-coupled receptor (GPCR) family. It is expressed on microglia, astrocytes, NK cells, monocytes/macrophages, and a subpopulation of T cells. CX3CR1 is the receptor for fractalkine (CX3CL1) and mediates both its adhesive and migratory functions. It also acts as coreceptor with CD4 for HIV-1 virus envelope protein (in vitro), and some variations in the gene of CX3CR1 lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Defects in CX3CR1 are a cause of susceptibility to age-related macular degeneration type 12 (ARMD12). The two CX3CR1 bands exhibited can be attributed to various factors (PMID: 30628679).