Tested Applications
| Positive WB detected in | HepG2 cells, human milk, rat lung tissue, mouse lung tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
| IF | See 5 publications below |
Product Information
26791-1-AP targets CXCL2 in WB, IF, Neutralization, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25376 Product name: Recombinant human CXCL2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 35-107 aa of BC015753 Sequence: APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 2 |
| Calculated Molecular Weight | 107 aa, 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC015753 |
| Gene Symbol | CXCL2 |
| Gene ID (NCBI) | 2920 |
| RRID | AB_3085904 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P19875 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CXCL2, also known as macrophage inflammatory protein 2-alpha (MIP2-alpha), is a member of CXC chemokine family that binds to CXC chemokine receptor 2 (CXCR2). CXCL2 is mainly produced by macrophages, endothelial cells, epithelial cells and tumor cells. CXCL2 plays important roles in various biological progresses such as angiogenesis, inflammation, immune response and cancer biological behaviors. Under inflammatory conditions in CNS, microglia and astrocytes may secrete CXCL2 as well as other chemokines, which induces chemotaxis and infiltration of circulatory neutrophils. Indeed, previous studies suggest that CXCL2 is involved in Alzheimer disease, multiple sclerosis and brain ischemia.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CXCL2 antibody 26791-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Cell Targeting the immune privilege of tumor-initiating cells to enhance cancer immunotherapy | ||
Acta Pharmacol Sin A novel resveratrol analog upregulates sirtuin 1 and inhibits inflammatory cell infiltration in acute pancreatitis. | ||
Int J Mol Sci MyD88 in Macrophages Enhances Liver Fibrosis by Activation of NLRP3 Inflammasome in HSCs. | ||
J Immunol Macrophagic Extracellular Vesicle CXCL2 Recruits and Activates the Neutrophil CXCR2/PKC/NOX4 Axis in Sepsis. | ||
Int Immunopharmacol Isoliquiritigenin alleviates LPS/ D-GalN-induced acute liver failure by activating the PGC-1α/ Nrf2 pathway to reduce oxidative stress and inflammatory response. | ||
Adv Sci (Weinh) Caspase-6/Gasdermin C-Mediated Tumor Cell Pyroptosis Promotes Colorectal Cancer Progression Through CXCL2-Dependent Recruitment of Myeloid-Derived Suppressor Cells |



