Tested Applications
| Positive FC (Intra) detected in | Transfected HEK-293T cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension |
| This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
98397-2-RR targets CXCL4/PF4 in FC (Intra) applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg3345 Product name: Recombinant Mouse CXCL4/PF4 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 30-105 aa of NM_019932 Sequence: VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES Predict reactive species |
| Full Name | platelet factor 4 |
| Calculated Molecular Weight | 11kd |
| GenBank Accession Number | NM_019932 |
| Gene Symbol | Pf4 |
| Gene ID (NCBI) | 56744 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9Z126 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2 - 8°C. Stable for one year after shipment. |
Background Information
CXCL4, also known as platelet factor 4 (PF-4), is the oldest member of the chemokine family. CXCL4 is a chemokine produced by activated platelets and immune cells involved in pathological conditions such as cancer, infections and inflammatory diseases like systemic sclerosis (SSc), rheumatoid arthritis (RA) and psoriatic arthritis (PsA), among others. CXCL4 is present in the α-granules of platelets in amounts that constitute up to 2% platelet protein mass. CXCL4 plays a determinant role in distinct physiological processes such as in hematopoiesis, angiogenesis, coagulation and modulation of immune responses. For instance, CXCL4 can prevent monocyte apoptosis and promote cell survival, induces the production of TNF and reactive oxygen species (ROS) and promotes monocyte differentiation into a unique macrophage-like phenotype.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CXCL4/PF4 antibody 98397-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



