CXCR2 Polyclonal antibody, PBS Only

• 

  WB analysis of L02 using 20634-1-AP (same clone as 20634-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 20634-1-AP (CXCR2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20634-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 20634-1-AP (same clone as 20634-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 20634-1-AP (CXCR2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20634-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 20634-1-AP (same clone as 20634-1-PBS)

  IP result of anti-CXCR2 (IP:20634-1-AP, 4ug; Detection:20634-1-AP 1:1000) with HepG2 cells lysate 3200ug. This data was developed using the same antibody clone with 20634-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 20634-1-AP (same clone as 20634-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 20634-1-AP (CXCR2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20634-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 20634-1-AP (same clone as 20634-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 20634-1-AP (CXCR2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20634-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 20634-1-AP (same clone as 20634-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon using 20634-1-AP (CXCR2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 20634-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 20634-1-AP (same clone as 20634-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon using 20634-1-AP (CXCR2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 20634-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse liver using 20634-1-AP (same clone as 20634-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using CXCR2 antibody (20634-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20634-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 20634-1-AP (same clone as 20634-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CXCR2 antibody (20634-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 20634-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CXCR2 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 20634-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

IL8RB, CD182, CDw128b, CMKAR2, C-X-C chemokine receptor type 2

---

Product Information

20634-1-PBS targets CXCR2 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14670

  Product name: Recombinant human IL-8RB/CXCR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-57 aa of BC037961

  Sequence: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYAL

• Full Name: interleukin 8 receptor, beta
• Calculated Molecular Weight: 360 aa, 41 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC037961
• Gene Symbol: IL8RB
• Gene ID (NCBI): 3579
• RRID: AB_10693624
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P25025
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IL8RB, also named as CXCR2, GRO/MGSA receptor, IL-8 receptor type 2, CDw128b, and CD182, belongs to the G-protein coupled receptor 1 family. It is a receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. The binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. It binds to IL-8 with high affinity. IL8RB also binds with high affinity to CXCL3, GRO/MGSA, and NAP-2.