Product Information
20634-1-PBS targets CXCR2 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14670 Product name: Recombinant human IL-8RB/CXCR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-57 aa of BC037961 Sequence: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYAL Predict reactive species |
Full Name | interleukin 8 receptor, beta |
Calculated Molecular Weight | 360 aa, 41 kDa |
Observed Molecular Weight | 45-50 kDa |
GenBank Accession Number | BC037961 |
Gene Symbol | IL8RB |
Gene ID (NCBI) | 3579 |
RRID | AB_10693624 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P25025 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
IL8RB, also named as CXCR2, GRO/MGSA receptor, IL-8 receptor type 2, CDw128b, and CD182, belongs to the G-protein coupled receptor 1 family. It is a receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. The binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. It binds to IL-8 with high affinity. IL8RB also binds with high affinity to CXCL3, GRO/MGSA, and NAP-2.