Product Information
20634-1-PBS targets CXCR2 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14670 Product name: Recombinant human IL-8RB/CXCR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-57 aa of BC037961 Sequence: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYAL Predict reactive species |
| Full Name | interleukin 8 receptor, beta |
| Calculated Molecular Weight | 360 aa, 41 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | BC037961 |
| Gene Symbol | IL8RB |
| Gene ID (NCBI) | 3579 |
| RRID | AB_10693624 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P25025 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
IL8RB, also named as CXCR2, GRO/MGSA receptor, IL-8 receptor type 2, CDw128b, and CD182, belongs to the G-protein coupled receptor 1 family. It is a receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. The binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. It binds to IL-8 with high affinity. IL8RB also binds with high affinity to CXCL3, GRO/MGSA, and NAP-2.



















