CXCR3 Recombinant monoclonal antibody

CXCR3 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA

Cat No. 84655-5-RR
Clone No.241790E9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

241790E9, CD182, CD183, CKR L2, CKR-L2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, mouse liver tissue, rat liver tissue
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84655-5-RR targets CXCR3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2269

Product name: Recombinant Human CXCR3 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 1-53 aa of BC034403

Sequence: MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR

Predict reactive species
Full Name chemokine (C-X-C motif) receptor 3
Calculated Molecular Weight 368 aa, 41 kDa
Observed Molecular Weight45 kDa
GenBank Accession NumberBC034403
Gene Symbol CXCR3
Gene ID (NCBI) 2833
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP49682
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CXCR3 (C-X-C chemokine receptor type 3) is a G protein-coupled, seven-transmembrane domain chemokine receptor that is expressed on the surface of several cell types, including activated CD4+ and CD8+ T cells, NK and NK-T cells, plasmacytoid dendritic cells, and some B cells (PMID: 16847335). CXCR3 binds and is activated by the three IFN-gamma-inducible chemokines: CXCL9, CXCL10, and CXCL11. The binding of these ligands to CXCR3 has been implicated in regulating T-cell infiltration during inflammation and tissue injury (PMID: 17250586). Alternatively, spliced transcript variants encoding different isoforms have been found for this gene. One of the isoforms, CXCR3B, mediates the angiostatic activity of CXCR3 ligands and also acts as a functional receptor for CXCL4 (PMID:12782716).

Protocols

Product Specific Protocols
IHC protocol for CXCR3 antibody 84655-5-RRDownload protocol
WB protocol for CXCR3 antibody 84655-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...