Use Able AI chat for product recommendations

CXCR3 Recombinant monoclonal antibody, PBS Only

CXCR3 Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84655-5-PBS
Clone No.241790E9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

241790E9, CD182, CD183, CKR L2, CKR-L2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84655-5-PBS targets CXCR3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2269

Product name: Recombinant Human CXCR3 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 1-53 aa of BC034403

Sequence: MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR

Predict reactive species
Full Name chemokine (C-X-C motif) receptor 3
Calculated Molecular Weight 368 aa, 41 kDa
Observed Molecular Weight45 kDa
GenBank Accession NumberBC034403
Gene Symbol CXCR3
Gene ID (NCBI) 2833
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP49682
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CXCR3 (C-X-C chemokine receptor type 3) is a G protein-coupled, seven-transmembrane domain chemokine receptor that is expressed on the surface of several cell types, including activated CD4+ and CD8+ T cells, NK and NK-T cells, plasmacytoid dendritic cells, and some B cells (PMID: 16847335). CXCR3 binds and is activated by the three IFN-gamma-inducible chemokines: CXCL9, CXCL10, and CXCL11. The binding of these ligands to CXCR3 has been implicated in regulating T-cell infiltration during inflammation and tissue injury (PMID: 17250586). Alternatively, spliced transcript variants encoding different isoforms have been found for this gene. One of the isoforms, CXCR3B, mediates the angiostatic activity of CXCR3 ligands and also acts as a functional receptor for CXCL4 (PMID:12782716).

Loading...
||
New chat

Able

正在加载,请稍候...